Detailed information on CNT30575942


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691897Oryza barthiiOryza sativa76.2570.5699.42520forward
CNT30677870Oryza barthiiSetaria viridis11.5831.2391.1479forward
CNT30282360Oryza barthiiChenopodium quinoa9.3831.2298.4464forward
CNT30553095Oryza barthiiOryza glaberrima58.5100.2598.75399reverse complement
CNT30205883Oryza barthiiHelianthus annuus10.563298.6172reverse complement
CNT30101056Oryza barthiiOryza rufipogon62.0295.9299.76423forward

Expression of CNT30575942

Peptides detected in this lncRNA

>peptide 1 (45 aa)
KKIIVWQNRIINQLQKHFFIVWLLGFEPRSPRPQRGILTTKLQPL*

>peptide 2 (86 aa)
MAPSFQTRYVVPNMTTVMSVKEAAMTITSVPNGSASNVHPSLGSRDDRFFPAFPSVSRSASSTRLPNSGFFPAAPAAADAAAALPFG

Sequence

>CNT30575942
AAAAAAATTATAGTGTGGCAGAATAGAATTATAAATCAGCTGCAAAAACATTTTTTTATAGTGTGGCTGCTGGGATTCGAGCCCAGGTCTCCACGGCCAC
AACGTGGAATTCTCACCACTAAACTACAGCCACTTTAGTGAAAAGAGAGGATGTAAACCCTATTTGTAAATATGATTTTTTTACTAATCATATTAGTAGA
ATAATAACTATATTAAGTAAACTATCGATTCGTACAACGATGTTCCAAAATCCACCCTAAAAACCAAAGCCGGCAGTTCAGTACAATATCACACGAGTAT
CTGATCAAAGCACCGCAAAAGGCAGCTACAAATCCAACGCGATTTCATCACCCAAAGACCCACAAATCTAGCGAGCTCATTGTGTGAGTGATAGTACGTA
GCCTAGAACTCGTTGAAGTGAATGGCGCCGAGCTTCCAGACGAGGTACGTGGTGCCGAACATGACGACGGTGATGAGCGTGAAGGAGGCGGCGATGACGA
TCACGTCGGTGCCGAACGGCAGCGCCTCGAACGTCCACCCTTCCTTGGGCAGCCGCGACGACCGCTTCTTCCCGGCCTTCCCGTCCGTCTCCCGGAGCGC
GTCCAGCACCCGGCTCCCGAACTCCGGCTTCTTCCCTGCCGCCCCAGCCGCCGCCGACGCCGCCGCGGCCTTGCCCTTCGGA