Detailed information on CNT30575941


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691920Oryza barthiiOryza sativa65.9610099.14467forward
CNT30552958Oryza barthiiOryza glaberrima68.9395.1399.39488forward
CNT30369966Oryza barthiiOryza glumipatula78.5375.9696.94556forward
CNT30101080Oryza barthiiOryza rufipogon61.16105.3594.46433forward
CNT30116402Oryza barthiiOryza nivara52.2610099.73370forward

Expression of CNT30575941

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MEMTIFRATTNTAQTCTLFLPPPIVLDYLATS*

Sequence

>CNT30575941
AGCAGATAGATAGATAGATAGATAGATAGCACAAGTAGTACGTACGTACACTGGAGGAAACTTTTATTTGACAGTACGCATTAAAATAACAAGATACATA
TATAGATGATCGATCTGATCATCAATAATCACACTGATAGATCGAGATAAGTATATATGTATGACACAACTGCAACACACAGACTAAGCCATGCAAAGCT
TAAGCCTTAATTAGGTAGCTAGGGTTGTGGTGGTAATGAAGATTAAGAATCAGATGAGTGGGCAGGAGAAGTCGGAAGGGCAGGTCTTGTGGCAGTAGTT
GAGGAGGAGGACGAGGTCGACGAGCCCCCCCAGCAGCGGGCAGCACTCCTCGCTCGCCGGCACCCCCACCTTGAGCTTGAGCAGGTTGAGCACGTTGGCG
CACACGCCCAGCTTCAGCGCGTCGATCGGACACTTATTCCCTCCACCCGACGGCGGCGACGGAGGCGGCGTCACCGGCGGCGTCGGGGTGGGGCAGTAGG
GCTCGCATGCCTGCACTGCACCCATCTGCATGGAGATGACCATATTCAGAGCAACGACGAACACCGCACAAACCTGCACCTTATTCTTGCCGCCGCCCAT
CGTATTGGACTACTTAGCTACTTCTTAATTGTACTAGCTTAATTAATTGATGATGATATAGTATATTTTGCTGCTGCTAGCTAGCTAGCTTGGGATGGTT
TCCTCGGG