Detailed information on CNT30575926


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT003442, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30692489Oryza barthiiOryza sativa92.9686.5699.1779forward
CNT30553012Oryza barthiiOryza glaberrima100.692.9497.39843forward
CNT30595987Oryza barthiiOryza meridionalis100.669.196.92843forward
CNT30369760Oryza barthiiOryza glumipatula93.3291.0498.85782forward
CNT30105059Oryza barthiiOryza longistaminata93.7984.4396.95786forward
CNT30101055Oryza barthiiOryza rufipogon97.1484.4499.02814forward
CNT30116356Oryza barthiiOryza nivara81.8664.2997.96686forward
CNT30603889Oryza barthiiOryza punctata93.5670.2592.98784forward
CNT30550796Oryza barthiiOryza brachyantha70.1746.384.18588forward

Expression of CNT30575926

Peptides detected in this lncRNA

>peptide 1 (39 aa)
MNGRSNLQWRIMDHRIGLSSRAIYDYMHSIIDAIMQVCN*

>peptide 2 (29 aa)
MMVLIIQFLLLILKVLCQDKKSLCKPSKP*

>peptide 3 (34 aa)
MKTIIIKRIEDSIFFFLGSAGKIIQIVEQVQVAI*

Sequence

>CNT30575926
ATGCATACTATGATGTCCAATGTGGGTGTCTGAACTGAAATCTGAACTCTGAACTCTGAAGGCTGTTGTTTCCATCAGGGTGCATTGGTTCAGCAGAGAT
CGGTGATCTATTGTTTTCATATTTGGTCACGTTCTACCGGTCTTTTTCGATGGAAATGAAGGTAATTGGAGGAGTTCTATCTGTTTGATGGAAGAACCAA
AATCCGAATTCCACAAAATGGCTAGAGGAAAATTTTTAGGGCTATTTGCAATTCCACAACCATAAGCATGGCCAACTGGTAGTTCTCCAAGTAAAAGAAG
TTAGGAGCTGGTTATGATGGTACTAATTATTCAGTTTCTTCTATTGATCCTGAAAGTTCTATGCCAGGATAAGAAAAGCTTGTGCAAACCCTCCAAGCCA
TGAAAACAATTATCATCAAGAGAATTGAAGATTCTATTTTTTTTTTCTTAGGATCTGCAGGGAAAATTATTCAGATAGTGGAACAGGTTCAAGTAGCCAT
TTGAAACTCAACACAACTTTATATCAAGAACAAATGAACAATGAATGGTAGATCCAATCTTCAATGGAGAATCATGGACCACCGAATTGGGCTATCTTCC
CGAGCTATCTACGACTATATGCATAGTATAATAGATGCAATCATGCAAGTGTGCAACTAGTAGTTTTTTTTTTTCTGAAGGAGATGAGATTAGGTATAGC
ATGTAATGGTCCTGGTGTATAATGCCATGGCACACTCAACTTGCATTTAAACAATGCTAGTCCCTGCAGACCTTGCCAAGTTCTCTGCTCATCCTCATTA
GGTAATTTGCCTTTGCTTGCTGCGTGTGCGCACCTAAA