Detailed information on CNT30575924


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9FIL7|CRCK1_ARATH, E-value = 2e-12

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553139Oryza barthiiOryza glaberrima98.5457.32100740forward
CNT30101031Oryza barthiiOryza rufipogon10050.7199.87751forward

Expression of CNT30575924

Peptides detected in this lncRNA

>peptide 1 (64 aa)
MVLTWINRDLVTCTSAPLRNRRPRNLKFILISGLPGHKATENSGETLRRRPERAAAANRAPADL*

>peptide 2 (52 aa)
MLSRCASSKPFPQDSAVCCICTNPDQFLLLGDLSTVNLQLNLLYLTSKTTKN*

>peptide 3 (29 aa)
RPSAPARRRPASPSACPSGARSMTGRSGG*

>peptide 4 (47 aa)
MERCKRKPDDGRPQEGMIGISGNSMARRSRGKISWSDYCFIVFPLDA*

>peptide 5 (44 aa)
PAIRASPTPASFAVSVSVRSTFDDRTFRWMIRCSANGEFQYVIA*

Sequence

>CNT30575924
GCCGGCCATCCGCGCCAGCCCGACGCCGGCCAGCTTCGCCGTCAGCGTGTCCGTCAGGAGCACGTTCGATGACCGGACGTTCCGGTGGATGATCCGCTGC
TCTGCAAACGGCGAGTTTCAGTATGTGATAGCATGAGCTACGTCGATCGCGATGTTGAGCCGTTGCGCAAGTTCTAAACCATTTCCACAGGATTCTGCAG
TGTGTTGCATTTGCACAAATCCTGATCAATTCCTCCTACTAGGTGACCTAAGTACAGTTAATCTGCAATTAAATTTACTCTACTTAACCAGCAAAACAAC
CAAGAACTGAAGAATTGGAAGGCACCAGAAGGCAGAATTGCTGGGCAAATTCCTCGATAGAGGAATGGTTCTTACCTGGATCAATCGAGACTTGGTAACC
TGTACTTCTGCTCCCTTGAGAAATCGTCGTCCGAGAAATCTCAAGTTCATCCTCATTTCTGGACTTCCTGGGCACAAAGCAACTGAAAACTCCGGCGAGA
CTCTGCGCCGCCGCCCTGAACGAGCCGCTGCTGCGAACCGAGCTCCTGCTGATCTCTGAAGATGGAACGCTGTAAGAGGAAGCCTGACGACGGTAGACCT
CAGGAGGGCATGATTGGTATCTCTGGCAATTCCATGGCAAGAAGATCGAGAGGAAAAATTTCTTGGTCTGATTATTGCTTCATCGTTTTTCCTTTGGATG
CATAAATATGGGGACGATGACTTGGTGCCGTTCAATGGCACAAGCCTTTGC