Detailed information on CNT30575897


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT006740, E-value = 3e-26

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30692277Oryza barthiiOryza sativa11.1253.791.88813reverse complement
CNT30673267Oryza barthiiSetaria viridis0.7723.0596.4356reverse complement
CNT30553121Oryza barthiiOryza glaberrima68.3495.8299.024994forward
CNT30110385Oryza barthiiOryza longistaminata35.3640.5396.792584forward
CNT30102974Oryza barthiiOryza rufipogon2.3120.6685.8169forward

Expression of CNT30575897

Peptides detected in this lncRNA

>peptide 1 (67 aa)
MELQDRWDYRRILRPEHTFASLPKTFPFSFNFCFGHQNCSLRHIAIILVCLCFSLFVTDSLIFSQGY*

>peptide 2 (34 aa)
MDYVCFNLPAQVLVNASNNLANARTTAILKSNLG*

>peptide 3 (34 aa)
MGRFLSGLEIDYTGDCQMGISMFCLGSEAPLDFI*

>peptide 4 (32 aa)
MSGKSNLGSWFFRNCNLQRVLFAASVGIIQAA*

>peptide 5 (31 aa)
MLSGFSDFRIQIVCLGILMWSSLMDGCWIIP*

>peptide 6 (30 aa)
MAFEDTKCKTIFVWMCAQFLILQSSLIPIS*

>peptide 7 (30 aa)
MASFGCNGYFGCNGYFNYEQSFDYHPSRIK*

>peptide 8 (61 aa)
MSPSPLRATPYLNWIDLIVRFACNVFEYFFPSPVTRSIRSDPIGSFSGFEFCVLPFLVFLL*

>peptide 9 (64 aa)
MKSVLLSIVVDLLFNIYKLRFGVALKLGLTKDHALGKKLFVWISSCEHLNLICPTILIRLFSCN*

>peptide 10 (97 aa)
MCKLKRLKLDWSNDHITGKKTMKPQYTHQLIYFQYLQSSFFVQQLEVLACWSCRYDIQNCSAKSIQIWMFFDLSKARLIPLTHHDIICLMFKQLPPK*

>peptide 11 (74 aa)
MMPKGGHGVELKGRCLFVVHGPMMLQRYYEVCIIINSGGFVVQYLQVKVWSCIEARFDQRSCIGKKTFCLDFFM*

>peptide 12 (44 aa)
MVNNFLICIINYQKLVTKKFDKICGFCVVQTSAIFNCMFIISVA*

>peptide 13 (42 aa)
MSTTTKFGFGLVTFYRRFNNLDDCFSRIPITRMIKRILGSDD*

>peptide 14 (59 aa)
MSQLVQILLYEVLYRKRMHKNLLLTGQHLVLARGKTSDLTHFVFYFHQFIHFLLVENKF*

>peptide 15 (56 aa)
MLTFNLWMDDHRFLSFLTRGDSERFDNLTLFSLGFDYLTSWHSDGSVCHPHKCQLK*

>peptide 16 (40 aa)
MTQAPQKLPLAVNSPKDKELTEIMMASKTQLTWYILVCRV*

>peptide 17 (38 aa)
MLVKTVQTKHMSLVDPMQTWHLKIQSVKQYLFGCVLSF*

>peptide 18 (41 aa)
MANLSEALNHHPFPFLIISRCSMLTKLNFFPNKWSLCLLQV*

>peptide 19 (41 aa)
MWDMDISDCSPSCFKFWELGISLVSALTRMQFSPIDSIGSI*

>peptide 20 (38 aa)
MFRSVCKRFFLPYVTTVCFADCLLCYLFLFLFLFFFAV*

>peptide 21 (35 aa)
MSSSQMSIKVIGQRKKCQIIKFFGDSRPWVDCCYL*

Sequence

>CNT30575897
AATTAATCATCCGCTAATTACTGATCCGTTTTCCGTGCGGGCACTTAAGTGTTAGGAAACCAGGGTTCCGAACACACCGACACCCGTCTCGCTGGCGCCA
GGGCTCCACACGCTCTTGCTTAAACCGACATCCAAAGCAAACGCGATTCGGCGCGCCGTGTGTTCGTCCCGTGTCCGGTATAAGGAAGCCGAAGTCGAAG
CCGACTTGGCGACCAGCACCGCCTCTCCGTCTCGTCCCTCCCGCCTATTTATTTAATTTCAGGCGACGCCTTCTCCCCCACCTCGCGCCACCCCCGGTCT
GCTTCTTCCCTTCTTCATCTTCTCTCGCCGGCGTGGTCGCGTTTTGCTTCTTCCCGTTTCCGATCTCCTCCTCTCTCTCGATTCGACTCGAGTTGTGTTT
TTTTGTTTTTCCTTTTCTTTTTATGATGAATCGGCGGGTTGATTTGGATCGTCCTCGTCCTTGTTTCCGCCTTCTGTGCCCGCAGATCTCCGGTGAGATG
AGATGAGCCCATCTCCGCTCCGCGCGACACCCTATCTGAATTGGATCGACTTGATTGTTCGGTTTGCTTGCAACGTGTTTGAGTATTTTTTCCCCTCTCC
GGTGACTCGATCGATCCGATCCGATCCGATTGGATCCTTCTCTGGTTTCGAATTCTGTGTTCTACCTTTTCTCGTGTTCCTCCTATAGGGCTTGTTTGGT
TGCAGGAGCGGATTTGATCCGGGATTGGAAGAGGGTTCCTGTGGCGTCGTGTGATTGGTTGGTGGAAAGGAGAGAGTGGGTGAAGACGTGAACGTTTCTT
GTCTACGATCCGTTTGATTTGGTCACTTGGTTTCGGTGATTTCAGATATGGCAATTTGAGTGGATATGCTAACCTTCAATCTATGGATGGATGATCATCG
GTTCTTATCGTTCCTCACGCGAGGTGATTCGGAGAGATTTGATAATTTAACACTCTTTTCATTGGGTTTCGATTATTTGACATCCTGGCACTCAGATGGT
TCCGTATGTCATCCTCACAAATGTCAATTAAAGTAATTGGACAACGAAAAAAGTGTCAAATTATCAAATTTTTCGGTGATTCGAGACCCTGGGTCGATTG
TTGTTACTTGTGACCGCTGATCTGGCTTGTTGTTGGCATGTGTTTGTGCTCCTCTAGATGATGCAGGAGGGATGATGACTGTTGAGATGAACCGGATCGG
TGGAGGTTGATTATTATATTGTCCAGGTTCATGGTTGTTTTGGATTCATGATGAATCGGGGTGCTGGAGGTTTGCTTATTATGGTTCTTGGTTTATTTTG
ATTTGCTTATTATGGTTCTTGGTTGTTTTGATTAGTGCACGGTTGTTCTGAAATTATCCTGACATTTCAAGTTTGTGGTGCCGTGGCAACCCTCACTGGA
TTTCCTTTGGTCAGATCCGCAAGATGGGCAGATTTCTAAGTGGTTTGGAGATAGATTATACGGGAGATTGTCAGATGGGGATTTCAATGTTCTGTTTGGG
TTCTGAAGCCCCCCTCGATTTTATTTAGTTGTCAGCATAATTTGATTTATGTCTGGAAAGTCTAATTTGGGAAGTTGGTTCTTCAGGAATTGTAATTTAC
AGCGAGTCCTATTTGCCGCATCAGTTGGAATTATACAGGCCGCCTAACAGTCCTTCTTTTGTGATCGACAACCTTTCACTGCTTAATCTTTGATAACTAA
GTTCTTAGATTTACCCGTTCTTTTACATGTCAGTAATTTGTAGTTCTTGCAGATACTCCTATTGCAAAGATGGAATTTGCAATATCTGCCTCGGTCTATA
CTAATATCTGCAAACTCCAGACAACTTCACCCCTGTGCCACTCAGTCTTTAAGTGATTTTGTTTATGCTTAGACTACTTTCCTCCAAAATAAAGTCTCCT
GGTCATTGCAAGGCTCCACATAATTTTTATGGCCAATCTGAGTGAAGCCTTAAATCACCACCCTTTTCCCTTCTTAATCATTAGTAGATGTTCAATGCTT
ACAAAGTTGAATTTCTTCCCAAATAAATGGTCTCTTTGCTTACTGCAGGTCTAGTTCATAATTTTACAAGGCCAATCTGATACTGAGTGAAATCTTTAAA
TCACCTTCTCTTCAATTCATCACTTAGAAGTTAAATATTTACAGAGTTGAATTTCTTCCCGAATAAATGGTCTCTTTCTCACTGCAGGTCTAGTTCATAA
ATTTACAAGGCCAACCTGATTCTGAGTAGGATTTAAATCACTACCCTTAAATTCTCACAAAGGTAGAATTTAAATACTCGGATTTACCTGCAGAGATGGA
ATTGTGTAGGAGTTATGGAGCTTCAAGATAGATGGGACTACAGGAGAATCCTACGACCAGAACATACTTTTGCTAGTCTGCCTAAAACTTTTCCCTTCTC
GTTCAATTTCTGTTTCGGTCATCAGAATTGCTCTCTACGACATATAGCTATAATTTTGGTGTGCCTTTGCTTTTCCTTGTTTGTCACAGATTCTTTAATT
TTCTCCCAAGGTTATTGATTGGAGGCTGTTGACTTGTTCGGTTTGTGTTCTATCACTGTACCTCAATCATTAAGTATAGTTCAATGCCTATGTTGTTTGT
TCGCATGATATAGTCATAGGGTCGGTCTGGGAATTGGAGCTCTGTATGTCAACAAAGGGGCATACAAGGTTTTGGTTGATATTTTGAGATTATGTTATCT
GGATTTAGCGATTTCAGAATACAGATCGTTTGTCTTGGCATTCTTATGTGGTCTTCCCTGATGGACGGTTGTTGGATTATCCCCTAGTTTGAGTGGATTC
AAGACAACCTGAGTTGGTTCTTTTTGTGGTATGAGTTCTGTTCTTGTTTAGATGATGCAGAAGGGTTTGCTTTTTGTTGATGGTTATTTTGATATAACGA
AGTTTGTGCTGCAATAGCTATGACAACCCTGATTGGATTTGTTGCTGCTCAGATATGTGCAAGTTAAAAAGGTTGAAGCTTGACTGGAGCAACGATCACA
TAACTGGAAAAAAGACCATGAAGCCACAATATACTCACCAACTCATTTACTTTCAGTACTTGCAGTCCAGTTTTTTTGTCCAGCAATTGGAAGTACTGGC
TTGTTGGAGTTGCAGATACGACATTCAGAACTGCAGTGCAAAATCAATACAGATTTGGATGTTCTTTGACCTCTCTAAAGCCAGGCTTATCCCTCTTACC
CACCATGACATAATTTGTCTGATGTTTAAGCAGCTTCCACCTAAATAAAGATTCATAGAAGATAGTATTTTGCTTGTTTCAGGCCTATTTTCGGTCATTT
TGTAAGGGCAATCCAACTCCAATTGAAATTTTCTGAACCACTAGCATTTTCCCTTCAACCCCTTATTGAAAATTCAATGCCCACAAAGACGGGAGGGTTC
GAGGGTGTGTTTTGGAGCTTCAAGCCAAGACAACTATATACTATTTAGTGCTCTCTTGCCTTGCATCTCTTGTTTTTGTGTCTATATTTCATTTGGTGTT
GCTTATGCCTTACTCTGCTTGCAGATTCTATTTTTTGTCCATGGTGACGTGGATATTTTCTTAAGAAGTTGACTTGTCTGGTTTGTGATATACCACTTTC
TGGGTTTGGTCCATTATCTCTAGATTCAGTGTCTTGTGGTGTTCTTGTTCGCATGTGATTGCAGGGCGGATCTAGAAAAATGAGCATGCGACAAAGCTAG
TATCTGGAAATTGAGGAAGGGCATGCAGTAGGGTCATCATACAAGGTCTGGTCGTTTCATAGATTATCTTGATTTGGATTATCTCTATGTTATCTTAGGT
TTTGGCATTTTGAGGAATCTCACCTAATTGGCCAGCTATCAGACCCATTAATCTTTACATAAGGTGGGAGTTCCGTACCTTTGGTTTATATTTTTTTGAA
AAACTTATCTTGTTTGGTATATGTGTTTCTATGCTCCTTTAGATGATGCCAAAGGGTGGACATGGAGTTGAATTGAAGGGTAGATGTTTGTTTGTGGTTC
ATGGCCCCATGATGTTACAACGGTATTATGAAGTCTGTATTATTATCAATAGTGGTGGATTTGTTGTTCAATATCTACAAGTTAAGGTTTGGAGTTGCAT
TGAAGCTCGGTTTGACCAAAGATCATGCATTGGGAAAAAAACTTTTTGTTTGGATTTCTTCATGTGAACACTTAAATTTAATTTGTCCAACAATACTTAT
CCGCTTGTTCTCCTGCAATTAGAAGTATATGGCTTGTTAGTTATTTTGGAACCACGCTGGATGTTCCCTTGTGATTTAACCAACTTCCCTGATTTCTCTT
GATAATCTATGTTAGTCAAAACTGTTCAGACTAAACATATGTCCCTTGTTGATCCAATGCAGACATGGCATTTGAAGATACAAAGTGTAAAACAATATTT
GTTTGGATGTGTGCTCAGTTTCTGATTCTTCAATCCAGTCTTATTCCTATCTCATAAGCCAGACTTATTCCTCTCTCATTGTGACATATTTTCATGCATG
TTGTGATATTTAAGTATTTTTTTGCCAAAATAAACATATAGTGGTCTCTTCCTCTTGTAGTTTCTTTGATAACCTTGCAAGACATTCTGCGGAGTAAAAC
CTGTTTACAGATTTATTAATTCTATTATCTCAAATCATTTTTCAGAAAGACCAACAAAATCTTTTATGCTGTTGAATATTTGAACTTGGATTTGATTTGC
AGAGGTCCAACATTCTAAGGCCTTTCAGGACTTGAAGTAGATAAAAGTCCACAGCTGGAAGACCTAAGTGCTGTCTTCCTAAACTTCAGACAAATCTGTT
CTGAGATAACTTAAATCGATACACTATTTTTTACCTGTTATATGACTACCCAATTTTAACCAATGGCTGTTTGGTTGGTTTTCACTTTCCAGCAGTTCAA
CATTGAATATGCACACAAAAGGATTTACAGTTCCTTCTGACCATCTAATAGTTTAAACAATTTCCTGAAAAGGTTCTTTATAGTTTCAGTATCCAATAAT
GATCACCATAAGATTCAAAACCAGTGTCGATAGCTTCTGAATCACAGGCTTAGTTATGTCACAGTTGGTGCAAATTTTATTATATGAGGTGTTATACAGA
AAAAGAATGCATAAAAATCTGTTGCTAACTGGACAACACTTGGTTCTTGCAAGAGGCAAAACATCTGATCTTACACACTTTGTTTTCTACTTCCATCAAT
TTATTCACTTTCTTTTGGTGGAAAATAAATTCTGAATGTTTCTTGTATTCAATATATAATTATTTTTGTTACATATTCTTTTATTACCTAAACTTATTTG
GCCTTTCGGAATGGCCTCTTTTGGTTGCAACGGCTATTTTGGTTGCAACGGCTATTTTAACTATGAACAGTCATTTGATTATCATCCTAGCAGAATTAAA
TAGTAGTTCAGAATGGCCTCATCATACTTGAAGACGTCAATATGATACTCCCGTACTATAAGGTCAGTCTTGTAGTGCACTTTGGATGGTCTTTGGCAAT
TCTTCTTTAGTTTCAGCAATCAAGAACAAGAAGCCAGTATACTGTTAGGCCACAAGATTGCTGTTATACTACTGGTACAAATAGAAGTGCATTTATTGTA
TTTGCAGATAGCCATGGAATTTCTGGAATTCAAATACATGTTGACAGCACATGACACAGGCTCCTCAAAAACTTCCGCTTGCAGTTAATTCACCCAAAGA
TAAGGAATTGACTGAAATAATGATGGCATCAAAGACACAATTAACATGGTACATATTGGTTTGTAGAGTTTGATGAAGGTCTTGTGTACCTGCTAGGGTT
CAAGCTAACGATGTCATGTGGGATATGGATATCAGTGATTGCTCGCCTTCCTGCTTTAAATTTTGGGAACTTGGTATATCACTGGTATCTGCTTTAACAC
GCATGCAATTTTCACCGATTGATTCTATAGGAAGTATCTGACACTTGAACGAAATCATTGGTTTGATCTCTTTGGTGCATCTTAGATCATTAACTGTGTT
TGACCACTGGTTCTACAAAGACTCGGCCAATTTGTCTCTTCTTATCAGTAGCGTTGAACCATTAAACTTGGTGCGCAAGCTGATCTATGGACTATGTCTG
CTTTAACTTACCTGCTCAAGTTCTTGTTAATGCAAGTAACAATTTAGCAAATGCTAGAACCACTGCAATACTGAAAAGTAATTTGGGTTGATCTATCCAT
ACAATGCGGTTGTGAAAAGAAGGGCTGGAATATCTATACTTACTCAGTTAGTGGATGGTCAACAATTTTTTGATATGCATCATTAATTACCAAAAATTGG
TCACCAAGAAGTTTGATAAGATTTGTGGATTTTGTGTAGTTCAGACTTCAGCCATCTTCAATTGTATGTTCATTATCTCAGTTGCCTAACAGTATCTTGT
TGCACATTATGTCTAGTGTTCAACTTTATATGAACCGGTGTTTGCTTAGTTTTACCCTCCTCTGCTCAAGTTGATACTTATACAACCGAACTGCAACCTG
ACATGGATATGTTTTATTGCATTTGTGCTCCTGCAGTAGGAGTCTAGGAGACCCCAATAATCTATGATGTACTAAAACTGAATGTGCCCCATTGTGGCCT
TCCTTTCCCAAGTTGACATATGTAAGATCAGTTAAGTCAATTGCGTTCTGACATGGAGACATTTTACTGCATTGAACATTTTTCATAGGAGGCCTCGACG
ATGTCGACCACAACAAAATTTGGATTTGGATTGGTCACTTTCTACCGACGATTCAATAACCTTGATGATTGTTTTTCTCGAATACCAATCACCCGGATGA
TTAAAAGGATTCTTGGTTCAGATGACTAATTTCATGACCAATTCTTCCTACTAATTCCAGTCAGTTGGTGTTTATATTGCTTACAATAGCTCATGCAATA
TTATTTTCCAGACTAGATTGTAGAAGCTATAACCTGCTTGATTTTTTGTTCATAAATTCAATTTGATCTCACTCTTGTGTTTCTATCTGTTGTTCGTGCT
GCCTTATGTTCAGATCTGTGTGCAAGCGGTTTTTTTTGCCTTATGTGACTACTGTGTGCTTTGCTGATTGTTTGTTGTGCTATTTGTTTTTGTTTTTGTT
TTTGTTTTTTTTTGCGGTTTAACACTGCCTTTGCCGGTCCCAAGCCCGGATGAAAAAATGTGGAGGGAACTGCAAGTAAGCTTCTTAATATGATTTGTGT
TGAAAAGTGAGAATGAATTTCTGCAGAATCTAACTAGAAATCTGGAATCAATATATTTGGTACAAAACTGAAAACTGGCACTGCCATCTAATTAGAAGTG
GTTGGCCC