Detailed information on CNT30575864


BLAST search results

BLAST vs Swiss-Prot:
sp|Q8H8T0|RGP1_ORYSJ, E-value = 1e-70

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30678520Oryza barthiiSetaria viridis30.1536.5392.57202forward
CNT30521866Oryza barthiiSetaria italica30.1549.8892.57202forward
CNT30185816Oryza barthiiSecale cereale23.4339.8586.62157forward
CNT30296517Oryza barthiiTriticum aestivum23.4355.8787.26157forward
CNT30223753Oryza barthiiHordeum vulgare18.9647.0488.98127forward
CNT30143197Oryza barthiiLolium perenne39.450.0990.53264forward
CNT30655253Oryza barthiiRosa chinensis14.1822.4685.2695forward
CNT30683620Oryza barthiiTriticum urartu40.653.7591.54272forward
CNT30595951Oryza barthiiOryza meridionalis14.7846.0597.9899forward
CNT30100642Oryza barthiiOryza rufipogon46.5751.2399.68312forward

Expression of CNT30575864

Peptides detected in this lncRNA

>peptide 1 (49 aa)
MVAFWKKGMMSSCQKMPLYSFFKFTKGLLALLCQMYGSPVFTPRLRLKG*

>peptide 2 (46 aa)
HHLATKARLSKLHDKIIIVLNYVNDDNKSFSSYKRTSITTKNYKVA*

Sequence

>CNT30575864
ACACCATTTAGCAACCAAAGCACGACTATCAAAATTACATGATAAAATTATTATTGTCTTGAATTATGTAAACGATGATAACAAATCCTTTTCCAGCTAC
AAAAGAACCAGCATAACAACAAAGAATTATAAAGTTGCTTAAGTAATCTCTCCCTTCTTCTCAAAAAGAGCTATATCTAGGGGGCCTAGGCCACAGCAAC
ACTTTCACTTAAAGGGTACTTTCCATCCTGCGACACACAAGCTCCCAGGATCAATCTACTTGGCCTTGCCGTTCTCGACAGCAGCAGTCGAGGGGTTCAG
CTCATCCCAGGCCTCGATCCAGGTGACCATGGCATCGGCAAGCTTGACGAAGTAGGGGTCGATCTTGCCGAGCTTCTCCTTGACCTGCTCGGCGAGGGAG
AGGTAGCACTTCTGGACGGTGTCGCACTCCTTGGGGATGGTGGCGTTCTGGAAGAAGGGGATGATGTCCTCCTGCCAGAAGATGCCCTTGTATTCCTTCT
TCAAGTTCACGAAGGGGTTGCTAGCCTTGCTGTGCCAGATGTACGGCAGTCCAGTCTTCACTCCCAGGCTCAGGCTGAAGGGGTAACCACGGACAAAGTC
AGCGCCTTCGCGGTAGGGATCATACAAGGTGTTGAAGAAGAACGGGGTGGACGGGCTGAGGAGGTTCTTG