Detailed information on CNT30575856


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9ZSP6|AIR1L_ARATH, E-value = 1e-07

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553011Oryza barthiiOryza glaberrima94.1497.7198.36852forward
CNT30447788Oryza barthiiSaccharum spontaneum16.2425.3489.8147forward
CNT30367039Oryza barthiiSorghum bicolor16.2425.1385.71147forward
CNT30105270Oryza barthiiOryza longistaminata51.8290.3792.96469forward
CNT30101097Oryza barthiiOryza rufipogon58.3453.2397.54528forward
CNT30593838Oryza barthiiEragrostis curvula16.6920.4692.72151forward

Expression of CNT30575856

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MGRLRLMPRMLARRAVQRHTAASRSARPWMR*

>peptide 2 (57 aa)
ELASTVRVELTGMQKRRDAVRTDAYTMRSIEYKLINQLCRYTYTSRRMKHALITSWN*

Sequence

>CNT30575856
AGAGCTAGCTAGTACAGTACGTGTAGAATTAACAGGCATGCAGAAAAGACGAGATGCAGTACGTACTGATGCATATACGATGAGATCCATCGAGTACAAA
TTAATTAATCAATTATGCAGATACACATATACAAGTAGACGAATGAAGCATGCTTTAATTACGTCGTGGAACTGAATCATATGCATGCATATATATCTCA
TTAATTTACGGGATGAAGGAGGAAATTAAGGCACGCAGATACATATGATGATTTGAACAAGGAACAAATTAGACATAGATAGATATATAGTTGTACGTGG
CCTGGTGGTCGTTCTTCGTACGTTCTTGTGTGTAGCAAGCAGTGAAGTAGAATGGAGCAGCAGCTATATTAGTTGCTGCACTGGAAGCCGGAGGGGACGG
AGCGGCCGCAGTAGTTGACGAGGAGGCTGAGGTTGATGGGGAGGTTGAGGTTGATGCCAAGGATGTTGGCGCGGAGGGCGGTGCAGAGGCACACGGCGGC
CTCAAGGTCGGCGAGGCCCTGGATGAGGTGAAGAAGAGGAGGTTCAGGGCCAGGAGCGTGGCGATCACCCCAGCTTTCGTCGCCATGCCCACCCACCGCA
CTGCACCTGCAGATCGATCTCGATCTATGGCCTGCCCTCTACCTAGCTTTGCTTGCTAGCCAGTGTATTCAGATACATCTATCGACCAAGGGGTGCACTC
ATATTTATAATAGGATCGGAGGTACTAGCGGAGTACCTTCAATTACTTAACCAGCTACCACATCACTTAACTAATTAATTAACTAATCGGATTTTAACTA
GGATTTCATCTTAGGTGCAGCTCACATCACTACAGCGTAACTACTACTAGTGACCTAGCTAGCTAGCTGGCCTGGAGTACATTAATTCATTGGAGTATAG
TGCTA