Detailed information on CNT30575846


BLAST search results

BLAST vs Swiss-Prot:
sp|Q10HD0|CB23_ORYSJ, E-value = 2e-137

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30521859Oryza barthiiSetaria italica65.569.8492.75579forward
CNT30187906Oryza barthiiSecale cereale44.9149.8190.43397forward
CNT30298671Oryza barthiiTriticum aestivum52.8368.3787.79467forward
CNT30393827Oryza barthiiTriticum turgidum66.0664.4687.67584forward
CNT30589923Oryza barthiiMusa acuminata33.9466.0892300forward
CNT30556099Oryza barthiiOryza glaberrima10090.6799.77884forward
CNT30245298Oryza barthiiAvena sativa45.0246.8884.92398forward
CNT30664531Oryza barthiiTriticum dicoccoides64.3782.5889.28569forward
CNT30454234Oryza barthiiSaccharum spontaneum64.4877.0385.09570forward
CNT30685368Oryza barthiiTriticum urartu64.7160.1587.41572forward
CNT30347916Oryza barthiiEragrostis tef20.5930.3395.6182forward
CNT30369866Oryza barthiiOryza glumipatula46.8356.3398.55414forward
CNT30579007Oryza barthiiEchinochloa crusgalli65.568.8591.54579forward
CNT30498674Oryza barthiiDigitaria exilis33.2643.4391.5294forward
CNT30116796Oryza barthiiOryza nivara95.791.4697.28846forward
CNT30603927Oryza barthiiOryza punctata45.2550.4496.25400forward

Expression of CNT30575846

Peptides detected in this lncRNA

>peptide 1 (41 aa)
TNWHRFSWLRCRSYNNDTSLIRSSLGCGLRLTLNLDPKKQR*

>peptide 2 (65 aa)
MHCCNCNCRVGAWLLQVYTWYVGWHHLDRVVVLTCRGRSWWRMPRRCWRRGRRRGRRGSRWGPCR*

>peptide 3 (94 aa)
MVRWLAPSRSCRCAHLPGTKLVAYAQALLATGSATWSKRFSMGPLPVTMAWTKKPNMENMARRPFLSSFTLSSAKAPPGYTLSRPSPSGPPPTR*

Sequence

>CNT30575846
CACAAATTGGCATCGTTTTAGCTGGCTTCGTTGTAGATCCTATAATAACGATACATCATTAATTCGATCATCCCTTGGATGCGGCCTGCGGCTTACATTA
AATCTCGATCCAAAGAAGCAAAGATGATGACAGACAGAAATTAATTAAGCTAGAAATCTCCTCGATCGATCACACACACACACACACACAATTAAGGTAC
ATACATACATGCACTGCTGCAACTGCAACTGCAGGGTCGGTGCGTGGCTACTACAAGTGTACACATGGTACGTTGGTTGGCACCATCTCGATCGTGTCGT
TGTGCTCACTTGCCGGGGACGAAGTTGGTGGCGTATGCCCAGGCGTTGTTGGCGACGGGGTCGGCGACGTGGTCGAAGAGGTTCTCGATGGGGCCCTTGC
CGGTGACGATGGCCTGGACGAAGAAGCCGAACATGGAGAACATGGCGAGGCGGCCGTTCTTGAGCTCCTTCACCTTGAGCTCGGCGAAGGCGCCGCCTGG
GTACACCTTGTCGAGGCCCTCGCCGAGCGGGCCGCCGCCGACGCGGTAGCCCTCGACGAATCCCATGAGCACCACCTGGACCGCCCAGATGGCGAGGATG
CTCTGCGCGTGCACCAGGTTGGGGTTCCCCAGGTAGTCGAGCCCCCCCTCGGAGAAGATCTGCGCGCCGGCCTTGAACCACACCGCCTCCCCGAACTTCA
CCCCGTTCTTGGACAGGATCTCCGGGAAGACGCAGCCCAGCGCCCCCAGCATCGCCCACCGCGAGTGGATCACCTCCAGCTCCCTGTTCCTCGCGAACGT
CTCCGGGTCGGCCGATAGCCCCGCCGTGTCCCACCCGTAGTCTCCCGGGAACTCTCCGGTCAGGTACGATGGCGTCTGCTCCGA