Detailed information on CNT30575811


BLAST search results

BLAST vs Swiss-Prot:
sp|A2XF66|H2B1_ORYSI, E-value = 7e-23

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30369782Oryza barthiiOryza glumipatula93.3951.0293.23325forward
CNT30100801Oryza barthiiOryza rufipogon10053.799.71348forward

Expression of CNT30575811

Peptides detected in this lncRNA

>peptide 1 (41 aa)
QDANQPPTINNTRHVYYFKSKPPIMIKHNLQSRHKFATTAT*

Sequence

>CNT30575811
CAAGATGCGAATCAGCCACCGACAATAAATAACACTCGACACGTCTATTACTTCAAATCCAAGCCGCCCATTATGATCAAGCACAATTTACAAAGCAGGC
ACAAGTTTGCAACTACTGCCACCTAGCACACTGCACACACGAGGGGAAAGGGAAGGAGAGAAGCATGGCATCGAAACCCTAGAGAGACAGGCCTAGTTGC
TGGTGAACTTGGTGACCGCCTTGGTGCCCTCGGAAACGGCGTGCTTGGCGAGCTCGCCGGGGAGGACGAGGCGGGCGGCCTCCTGCGCGAGCTTCTCGAA
GATGTCGTTGATGAAGGAGTTCATGATCGACATGGCCTTGGAGGAGAT