Detailed information on CNT30575777


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT006018, E-value = 2e-26

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT3020893Oryza barthiiCitrullus lanatus34.45.8288.6697forward
CNT30336644Oryza barthiiCynara cardunculus34.46.4587.6397forward

Expression of CNT30575777

Peptides detected in this lncRNA

>peptide 1 (44 aa)
MHDKIKTVQINIVPVRNYPLSQYXLYHHLYSLYQFAYPTCLVCLA

>peptide 2 (39 aa)
VRFYKKKKWFVKNKKCAREKMERAKQIPISNQYISLRYV*

Sequence

>CNT30575777
GTCCGATTCTATAAGAAGAAAAAATGGTTCGTAAAAAATAAAAAATGCGCGCGAGAAAAAATGGAAAGGGCGAAACAAATTCCGATTTCTAATCAGTATA
TATCTCTTCGCTATGTCTAATCTAATCTAACTATTTAAAAAGAGAAAATGCACGACAAAATAAAAACGGTTCAAATAAACATTGTACCCGTACGGAATTA
TCCTCTTTCTCAGTATNATCTCTATCATCATCTCTATTCCCTTTATCAATTTGCCTATCCTACCTGCCTTGTCTGCTTAGCC