Detailed information on CNT30575742


BLAST search results

BLAST vs Swiss-Prot:
sp|Q6ENB7|YCF68_ORYNI, E-value = 2e-61

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30533065Oryza barthiiEucalyptus grandis43.7525.9388.27196forward
CNT30403753Oryza barthiiBeta vulgaris24.115.0487.96108reverse complement
CNT30712184Oryza barthiiGlycine max99.5574.3389.91446forward
CNT30637537Oryza barthiiCapsicum annuum56.9242.4381.18255forward
CNT30714122Oryza barthiiMalus domestica golden51.5655.9388.31231forward
CNT30627901Oryza barthiiDaucus carota97.5437.3591.99437forward
CNT30684661Oryza barthiiTriticum urartu99.5510.5496.64446forward
CNT30722080Oryza barthiiTriticum spelta26.7956.3497.5120reverse complement
CNT30362263Oryza barthiiSorghum bicolor90.1846.7195.79404forward
CNT30595932Oryza barthiiOryza meridionalis81.0327.3197.8363forward
CNT3057391Oryza barthiiAmborella trichopoda66.745.9284.28299forward
CNT30318962Oryza barthiiAsparagus officinalis99.3321.3493.71445forward
CNT30148380Oryza barthiiBrachypodium distachyon62.520.6597.14280forward
CNT30726606Oryza barthiiLupinus angustifolius100.2238.0889.76449forward

Expression of CNT30575742

Peptides detected in this lncRNA

>peptide 1 (74 aa)
MGSHLNRPIYPPEEKFVWFQTPIQTGGVRHANVPWMIHIFVSGTDEHIELSMWLRALTAMAQRRNYQGRALPLS*

Sequence

>CNT30575742
ATGATCTCGTAGTTCTTGGTCTGTGAAGATGCGTTGTTAGGTGCTATATTTTCCCATCGAGGACGAACCTCAACCTGTGCTCGAGAGATAGCTCTCCATA
CATTGATAAGGGATGTATGGATTCTCGAGAAGAGAGGAGCCGTAGTGCCCCCCCCGGACCGCCCGGATCCCACGAGTGAATAGAAAGTTAGATCTACATG
GGATCTCACCTGAATCGCCCCATCTATCCTCCTGAGGAGAAGTTTGTTTGGTTTCAAACTCCGATTCAAACAGGAGGAGTACGCCATGCTAATGTGCCTT
GGATGATCCACATATTCGTGTCGGGCACTGATGAGCACATTGAACTATCCATGTGGCTGAGAGCCCTCACAGCCATGGCACAACGACGCAATTATCAGGG
GCGCGCTCTACCACTGAGCTAATAGCCCGTCGCGCAGGCCTCCCATCC