Detailed information on CNT30575705


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT001792, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694266Oryza barthiiOryza sativa55.4767.498.57978reverse complement
CNT30553641Oryza barthiiOryza glaberrima43.3468.7798.82764forward
CNT30371243Oryza barthiiOryza glumipatula50.3171.8295.6887forward
CNT30108528Oryza barthiiOryza longistaminata37.199.2498.62654forward
CNT30100385Oryza barthiiOryza rufipogon71.4792.7298.11260reverse complement
CNT30117644Oryza barthiiOryza nivara84.2384.4297.981485forward

Expression of CNT30575705

Peptides detected in this lncRNA

>peptide 1 (37 aa)
MVWIVWFISVLTFLITACRDVRIFRGDSAEISNNFRT*

>peptide 2 (31 aa)
MHKSCVCFTSSRLYLLSILYSLLCLIWFLGT*

>peptide 3 (54 aa)
MAMTLCYLFVFRPIFKFMTLFMFHYSGCSVYIIQEPCVAMGVQFGSLFMILEKR*

>peptide 4 (72 aa)
LLVVHGLLLLPIFVSAAAAGLQRTGRRERRQRRTGRKERRGNLIGEGKFGEFGEYFQILPFSYTLVLLGNPV*

>peptide 5 (46 aa)
MLLIRVSTHIQIHDVIHVSLFRMFCLHYSRTMRSHGSAIWIFIHDP*

>peptide 6 (53 aa)
LAGGARVAVAADIRFCCCCWPATNRKEGEKAEKNRKEGKKGKFDRRREIWGIW*

>peptide 7 (43 aa)
PCWWCTGCCCCRYSFLLLLLACNEQEGGREGREEQEGRKEGEI*

Sequence

>CNT30575705
CCTTGCTGGTGGTGCACGGGTTGCTGTTGCTGCCGATATTCGTTTCTGCTGCTGCTGCTGGCCTGCAACGAACAGGAAGGAGGGAGAGAAGGCAGAGAAG
AACAGGAAGGAAGGAAAGAAGGGGAAATTTGATAGGAGAAGGGAAATTTGGGGAATTTGGTGAATATTTCCAAATTCTTCCTTTTTCTTATACATTAGTA
CTGCTAGGTAATCCGGTTTAGTCTATAGTTGTTTCTAATTTATATTTAAGACGATCTGTTTCCGGTTTTTTCGAATTTATTTTATATCGAACGCTAGGCT
GAAACCGTATTTTCAAATCTGGTATTAAACCATCAGGAATCAGGTTAGTTGTCCTAAATAAAGTTTGTAGTCATTGTCAATATCTTTCCAACGGTGCTAG
TTTCACTCGATTCCGATAAACGGTTTAGGAGAAACAGCAAAAACAGTACTACTGACCGGGTCCGGAAATCAGGACAGCAGTTCGTTTTTCCTTAATCTGG
GATTTTTAGAGGCATAATCTGATTTTGTGCTCAACATGAAAGTTGTAGACAATTTTGTCTAGATGTCCGAAGTTGTATTATTTGCTAGTTTCCATTAGAC
GGTTTGTGAGTTACTCATAAAACAGTAATGGAACAGCTATAGGTTATTTAATACAAATCGGTAAAAGGTTTATATGTTCTAGGTTTCGATTTTAGTAAAT
ATCCCTTGTAACCGTCGTTAGTTGAATATAGTGGTTTATGCGTAGTTTTGCTCCACAGGTGTGGAGGGTTCCAACGTTGGAGGAGTTGAGTCGGAGTATC
GAATGAGTTAAGGCAAGTACAAGACGGATTTATGTGATGGACAAAACTGAGTTGTTTTGTTTGGCTTTACTTGCATAATTATTATTCAATTGCTTGTTAT
TACTGATTGTATGGCTATGACGTTATGCTACTTATTCGTGTTTCGACCCATATTCAAATTCATGACGTTATTCATGTTTCATTATTCCGGATGTTCTGTT
TACATTATTCAAGAACCATGCGTAGCCATGGGAGTGCAATTTGGATCTTTATTCATGATCCTTGAGAAGCGCTGATCACGCTTGCTCGGCTTATCGGTAA
TGCTAAAAGGATATTCACACCTGCCCGGGAGGGAACTACTATCTTTTGACTTCTTTGGTTTAAAAATAAAGTAAATCCAACCCTTCATGTTGGTTTCTTA
ATGCATAAATCATGCGTATGTTTTACTAGTTCAAGATTGTACTTGCTGAGTATTCTTTACTCACTCTTGTGTTTAATTTGGTTTTTAGGTACCTAATGAC
ATCGATCGGCATGGGGCGGGAGTAGCACCCTTGCACTACACATTATTATTGCACACAATTGAAATTAGTTTTAGACTATAATTTTTGCTCAGCATAAGTT
TTGCATAGAACTTGTAAAGGTCATTTAAGGTTCTGATCCTTATTTTTCACGTGGGATTTGTGGAGCTAGGATGGTTTGGATTGTGTGGTTTATATCGGTA
TTGACCTTTCTTATAACTGCCTGTCGTGATGTCCGTATTTTTAGGGGAGACTCTGCCGAAATTTCTAATAATTTTAGGACTTAGTTTTTGAGTGTATTTT
GGTGTGGCATTCTAGGTACGTGGTTAACTGGGGTGTTACACTATCGCTGACCGAAAATGTGATAATTGAGCAGTTACAAGACTACATAACCATCTTAATA
TTATTGTACGGCAATAGGACTTGCCTAGCTACAAATTGGGGGACCTCAATGTTATGACGTGGC