Detailed information on CNT30575695


BLAST search results

BLAST vs Swiss-Prot:
sp|Q39176|ERLI1_ARATH, E-value = 3e-33

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30552993Oryza barthiiOryza glaberrima84.2593.8699.44535forward
CNT30684877Oryza barthiiTriticum urartu26.326.3486.83167forward
CNT30369831Oryza barthiiOryza glumipatula80.3183.299.02510forward
CNT30105280Oryza barthiiOryza longistaminata93.8695.5192.79596forward
CNT30100768Oryza barthiiOryza rufipogon93.3984.4795.62593forward
CNT30116368Oryza barthiiOryza nivara83.9485.5597.75533forward

Expression of CNT30575695

Peptides detected in this lncRNA

>peptide 1 (74 aa)
MPRMLARRAVQRHTAASRSARPWMRLQHGCRGGVPSCTFISPFSTFAHTPSFSVSIGHLPPPPPPPLPPPPPPPL

>peptide 2 (55 aa)
ASTVRVELTGMQKRRDAVRTDAYTMRSIEYKLINQLCRYTYTSRRMKHALITSWN*

Sequence

>CNT30575695
AGCTAGTACAGTACGTGTAGAATTAACAGGCATGCAGAAAAGACGAGATGCAGTACGTACTGATGCATATACGATGAGATCCATCGAGTACAAATTAATT
AATCAATTATGCAGATACACATATACAAGTAGACGAATGAAGCATGCTTTAATTACGTCGTGGAACTGAATCATATGCATGCATATATATCTCATTAATT
TACGGGATGAAGGAGGAAATTAAGGCACGCAGATACATATGATGATTTGAACAAGGAACAAATTAGACATAGATAGATATATAGTTGTACGTGGCCTGGT
GGTCGTTCTTCGTACGTTCTTGTGTGTAGCAAGCAGTGAAGTAGAATGGAGCAGCAGCTATATTAGTTGCTGCACTGGAAGCCGGAGGGGACGGAGCGGC
CGCAGTTGATGCCAAGGATGTTGGCGCGGAGGGCGGTGCAGAGGCACACGGCGGCCTCAAGGTCGGCGAGGCCCTGGATGAGGCTGCAACACGGCTGCCG
CGGCGGCGTCCCCAGCTGCACGTTTATCAGCCCATTCAGCACGTTCGCGCACACCCCCAGCTTCAGCGTGTCGATCGGGCATCTTCCTCCTCCCCCGCCG
CCGCCGCTTCCTCCTCCTCCGCCGCCTCCGCTTCC