Detailed information on CNT30575656


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30101071Oryza barthiiOryza rufipogon10058.1398.74397forward

Expression of CNT30575656

Peptides detected in this lncRNA

>peptide 1 (62 aa)
MQILRGGHPAVDTLKTNGKLRAGTKDKRHTYCWQLAASGCGAGGFAKAGGVDISGGIRHILAS

>peptide 2 (75 aa)
MRGKGSHRTQGDDANSARRTSSCGYSQNERQTEGWHKGQKTHILLAASCFRMWCWWICQGRGRGYQWWNSSYPCFL

Sequence

>CNT30575656
GCCGATACCACGCGCTAGCTCGCCGCGCCGCCGCCTGCTCCCGACTCGCGTCCGCCATCGCCAACCTAGAAGCTAGCTAGAGGCTTACGAGGTGTTCTCG
TGATCGAGGGCCGTTCGATCGCACTGGATTGGGAGGGAGGGGGACGGCGTCCTGCAGCTGTTCGACAGAATGCGTGGCAAGGGATCACACAGAACTCAGG
GAGACGATGCAAATTCTGCGAGGCGGACATCCAGCTGTGGATACTCTCAAAACGAACGGCAAACTGAGGGCTGGCACAAAGGACAAAAGACACACATATT
GCTGGCAGCTAGCTGCTTCAGGATGTGGTGCTGGTGGATTTGCCAAGGCAGGGGGCGTGGATATCAGTGGTGGAATTCGTCATATCCTTGCTTCTTG