Detailed information on CNT30575620


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30692252Oryza barthiiOryza sativa83.8791.0299.5598forward
CNT30553128Oryza barthiiOryza glaberrima90.3285.41100644forward
CNT30107330Oryza barthiiOryza longistaminata32.2685.1995.22230forward
CNT30100741Oryza barthiiOryza rufipogon57.3687.0299.27409forward
CNT30116257Oryza barthiiOryza nivara52.0364.399.46371forward

Expression of CNT30575620

Peptides detected in this lncRNA

>peptide 1 (30 aa)
SIGRQIGSSGSDDPAAAPAGGGDMAVSWGA*

>peptide 2 (68 aa)
VRSGDKSVPPAPMTPRRRRPAAAIWRFRGGLERVDHRCALAAVDRDDGGSLLSASPGPLQLHNILDKH*

Sequence

>CNT30575620
GTTCGATCGGGAGACAAATCGGTTCCTCCGGCTCCGATGACCCCGCGGCGGCGCCGGCCGGCGGCGGCGATATGGCGGTTTCGTGGGGGGCTTGAGCGTG
TCGACCACCGGTGTGCCCTCGCCGCCGTGGACCGAGACGACGGCGGCTCCCTCCTCTCTGCTTCCCCAGGTCCACTTCAGCTGCACAATATACTGGATAA
GCACTGAACGAAGACTGTATTAACTTATTAGCAGTTTGAAACGTATTTGATGCCCGTGCCAAGCAACTAAACAAGAGGCCTTCGAATTGTCATTGACGAA
GACCTGAGCTACGGGCCTAAGGTGTGTCCATGTTTTACTCCAGTTTGGATCATGTGACCGGCATCTTGGATCTTGCCAATTGCAGTCCCAGAAATTCAGG
TAGGAGCAAATGAAATGAGGGGCATATGCAAATTGGGACTATCTTTAGGACACGTTTGCAGGCAGGATTATTTTTGCCGTTTATATGGGAAATCGAGCTG
ATTTGAATTAGATTCCTGTATTTGGTTTCATGTACTTGAGTTGAATGCGCTTAAATGCGTCCGATTTCCATAGGCTTCAGTAGAGCGTGTTTAATGTTCT
TTCTACCTCCAATTTTAGCAACTCTTTGATTCTGTGCGCATGCAGCATATTTCTTCCAAGGAAGTACACCTATCATGAAAGATTCGTTGTAAAAATATGA
ACTAAAATCGAAC