Detailed information on CNT30575580


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30678075Oryza barthiiSetaria viridis32.5421.2594.5109forward
CNT30522256Oryza barthiiSetaria italica23.2816.6797.4478forward
CNT30628528Oryza barthiiVigna unguiculata21.19888.7371forward
CNT30296934Oryza barthiiTriticum aestivum23.2814.596.1578forward
CNT30392788Oryza barthiiTriticum turgidum30.157.7694.06101forward
CNT30592382Oryza barthiiMusa acuminata27.1615.2993.4191forward
CNT3084571Oryza barthiiVigna radiata22.396.0890.6775forward
CNT30552975Oryza barthiiOryza glaberrima62.9936.38100211forward
CNT30242094Oryza barthiiAvena sativa23.2821.291.0378forward
CNT30137220Oryza barthiiLolium perenne35.228.0488.98118forward
CNT301194Oryza barthiiZea mays22.6915.2396.0576forward
CNT30721484Oryza barthiiTriticum spelta23.2810.6796.1578forward
CNT30331222Oryza barthiiDioscorea rotundata32.8414.0185.45110forward
CNT30579360Oryza barthiiEchinochloa crusgalli30.1516.6497.03101forward

Expression of CNT30575580

Peptides detected in this lncRNA

>peptide 1 (83 aa)
MRETKRLDRSRRRGDHGQAAAAAMSLVVGGGELLVGVGDEEDLVDDAGEAEGAGGEPAGGEAEEEARHGGAQELGDPVEEAAEQ

>peptide 2 (33 aa)
MTPARPKVPVASPPVEKRRRKHATVEPRSWAIQ*

Sequence

>CNT30575580
CGGGTTCCCAAAGGTCCACACTTACAGTACGTTCAACGTACAACTGATCCAAGCAAATGAAACAGGTTTGATGATGCACTGATGCGAGAAACTAAACGGT
TGGATCGGAGTCGGAGACGAGGCGATCATGGACAAGCGGCGGCGGCGGCGATGAGCTTAGTAGTCGGTGGTGGGGAGCTGCTCGTGGGTGTGGGAGATGA
AGAGGACCTCGTAGATGACGCCGGCGAGGCCGAAGGTGCCGGTGGCGAGCCCGCCGGTGGAGAAGCGGAGGAGGAAGCACGCCACGGTGGAGCCCAGGAG
CTGGGCGATCCAGTAGAGGAGGCCGCGGAACAGGG