Detailed information on CNT30575574


BLAST search results

BLAST vs Swiss-Prot:
sp|Q10HD0|CB23_ORYSJ, E-value = 5e-90

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30394291Oryza barthiiTriticum turgidum51.545789.53468forward
CNT30440221Oryza barthiiAegilops tauschii33.4897.7588.49304forward
CNT30453153Oryza barthiiSaccharum spontaneum41.5247.5487.27377forward
CNT30100870Oryza barthiiOryza rufipogon54.8592.0599.2498forward
CNT30498755Oryza barthiiDigitaria exilis22.836.2591.3207forward
CNT30556788Oryza barthiiPanicum hallii41.1952.7586.9374forward

Expression of CNT30575574

Peptides detected in this lncRNA

>peptide 1 (95 aa)
MVRWLAPSRSCRCAHLPGTKLVAYAQALLATGSATWSKRFSMGPLPVTMAWTKKPNMENMARRPFLSSFTLSSAKVSGSSARPSGPSPSGPPPTR*

>peptide 2 (33 aa)
DEGPRVNIFLSRSQGPAGARERETQARNAGVLA*

>peptide 3 (65 aa)
MHCCNCNCRVGAWLLQVYTWYVGWHHLDRVVVLTCRGRSWWRMPRRCWRRGRRRGRRGSRWGPCR*

Sequence

>CNT30575574
GACGAGGGACCCCGAGTGAACATTTTCCTTAGCCGCTCGCAGGGTCCAGCTGGGGCGCGGGAGCGCGAGACGCAAGCCCGCAACGCTGGCGTGCTCGCGT
GAACTGGGTCCCGCACCGATTTATTGGGTCGACGCACAAATTGGCATCGTTTTAGCTGGCTTCGTTGTAGATCCTATAATAACGATACATCATTAATTCG
ATCATCCCTTGGATGCGGCCTGCGGCTTACATTAAATCTCGATCCAAAGAAGCAAAGATGATGACAGACAGAAATTAATTAAGCTAGAAATCTCCTCGAT
CGATCACACACACACACACACACAATTAAGGTACATACATACATGCACTGCTGCAACTGCAACTGCAGGGTCGGTGCGTGGCTACTACAAGTGTACACAT
GGTACGTTGGTTGGCACCATCTCGATCGTGTCGTTGTGCTCACTTGCCGGGGACGAAGTTGGTGGCGTATGCCCAGGCGTTGTTGGCGACGGGGTCGGCG
ACGTGGTCGAAGAGGTTCTCGATGGGGCCCTTGCCGGTGACGATGGCCTGGACGAAGAAGCCGAACATGGAGAACATGGCGAGGCGGCCGTTCTTGAGCT
CCTTCACCTTGAGCTCGGCGAAGGTGTCAGGGTCGTCGGCGAGGCCGAGCGGGCCCTCGCCGAGCGGGCCGCCGCCGACGCGGTAGCCCTCGACGAATCC
CATGAGCACCACCTGGACCGCCCAGATGGCGAGGATGCTCTGCGCGTGCACCAGGTTGGGGTTCCCCAGGTAGTCGAGCCCCCCCTCGGAGAAGATCTGC
GCGCCGGCCTTGAACCACACCGCCTCCCCGAACTTCACCCCGTTCTTGGACAGGATCTCCGGGAAGACGCAGCCCAGCGCCCCCAGCATCGCCCACCGCG
AGTGGATC