Detailed information on CNT30575483


BLAST search results

BLAST vs Swiss-Prot:
sp|P20144|WUN1_SOLTU, E-value = 5e-19

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30692341Oryza barthiiOryza sativa6.1323.6210060forward
CNT30589033Oryza barthiiMusa acuminata8.072086.0879forward
CNT30136604Oryza barthiiLolium perenne32.7938.2189.1321forward
CNT30595947Oryza barthiiOryza meridionalis47.1964.4498.05462forward
CNT30369763Oryza barthiiOryza glumipatula47.1976.3699.13462forward
CNT30100799Oryza barthiiOryza rufipogon47.1925.699.35462forward

Expression of CNT30575483

Peptides detected in this lncRNA

>peptide 1 (39 aa)
ATSTFMQQQQTIIHIQPRFSFTVEGVHTYIIHNDLDQSY*

>peptide 2 (29 aa)
LRVLLCNNNRPSFIFSHGLALPWKEYTLT*

>peptide 3 (88 aa)
MARTRPGSDLCARSARRLCHRHLGLDGGGGGEAGDGEVGVEVLPELGDYPIGADGPGVHPVELAGVVGALGDDGGAEGVDGARGEEEP*

>peptide 4 (75 aa)
MTVEPKASTERGEKRNLDSPWSAPVRRRIMCWCAGGPWNHHSRSGASSSCALRASPELSASYSRSTRNLASCSSG*

>peptide 5 (73 aa)
MEPPLEVRREQLLRPARVPGVERLVQPQHQELGVLLLRLIPCAVQLCQLRHRRRRLARRRRRSLPVVSQLLARA

>peptide 6 (68 aa)
MSFEFVLRWRGRGPAATCARGRRGGSATGTWAWTAAAAERRVTVRSVLKYSLSWVITPSGPTVQACTQ*

>peptide 7 (41 aa)
MLLVTLLIQLSDKQAKATLLNWLASCSSGSGINHANLKQLS*

Sequence

>CNT30575483
AGCTACGAGTACTTTTATGCAACAACAACAGACCATCATTCATATTCAGCCACGGTTTAGCTTTACCGTGGAAGGAGTACACACTTACATAATCCATAAT
GACTTGGACCAAAGCTACTGATGCTACTGGTCACACTGCTGATTCAGCTTTCAGACAAGCAAGCAAAAGCAACACTACTTAACTGGCTGGCTAGTTGCAG
TAGTGGTAGTGGGATTAATCACGCAAACCTGAAGCAGCTCAGTTGAGCTGAGCGGCTTTAGCCCATAAGCAATAAACTATAGCTAGGGACTTCACTCAGT
GCGTGCGCTTCCGTTTTTATTTATTTAGCTAATCACTATTGATAAGTATCGCTTGATTTTTTTTATATATGATTAATTTAGGGAAGCTTTTTGCGCCTTG
AGTTCTTGATGTCTTTTGAGTTCGTTCTTAGATGGCGAGGACGAGGCCCGGCAGCGACTTGTGCGCGCGGTCGGCGCGGCGGCTCTGCCACAGGCACTTG
GGCTTGGACGGCGGCGGCGGCGGAGAGGCGGGTGACGGTGAGGTCGGTGTTGAAGTACTCCCTGAGCTGGGTGATTACCCCATCGGGGCCGACGGTCCAG
GCGTGCACCCAGTAGAGCTGGCGGGTGTCGTCGGTGCCCTCGGCGATGACGGTGGAGCCGAAGGCGTCGACGGAGCGAGGGGAGAAGAGGAACCTTGACT
CGCCGTGGTCGGCGCCGGTGAGGAGGCGCATCATGTGCTGGTGCGCCGGCGGCCCATGGAACCACCACTCGAGGTCCGGCGCGAGCAGCTCCTGCGCCCT
GCGCGCGTCCCCGGAGTTGAGCGCCTCGTACAGCCGCAGCACCAGGAACTTGGCGTCCTGCTCCTCCGGCTGATCCCTTGCGCCGTCCAGCTCTGCCAGC
TCCGACACCGACGCCGACGCCTCGCGCGCCGCCGCCGCCGTTCCCTGCCTGTGGTTAGCCAGCTCCTGGCGCGAGCCCC