Detailed information on CNT30575135


BLAST search results

BLAST vs Swiss-Prot:
sp|Q67YI9|EPN2_ARATH, E-value = 1e-08

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30520016Oryza barthiiSetaria italica25.9529.2787.03185forward
CNT30552581Oryza barthiiOryza glaberrima55.2663.45100394forward
CNT30666600Oryza barthiiTriticum dicoccoides30.8626.1384.55220forward
CNT30460493Oryza barthiiSaccharum spontaneum30.8625.3786.36220forward
CNT30139889Oryza barthiiLolium perenne30.8623.9986.36220forward
CNT30116023Oryza barthiiOryza nivara54.745.1998.97390forward

Expression of CNT30575135

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MERTSRCSICLRNCRSFFMNSLERRRIPKRISCIK

>peptide 2 (29 aa)
ERIVSGGADELDCNGKFTPEGIEFGTARG*

>peptide 3 (85 aa)
LKGLFQGELMNLIVMESSHQKALNSALQEAEMPLEKLMLPVKLPWQFVGERLAERAVDLLELQIEKPVKGCRMVLHSVKEPQTCH*

>peptide 4 (64 aa)
MGLPVQGAQMGLQVVPLNVMRWAQKYLAAQVQHSIQKRGRQECLQNQSLLLKQAGKDLHLQQVQ*

Sequence

>CNT30575135
CTGAAAGGATTGTTTCAGGGGGAGCTGATGAACTTGATTGTAATGGAAAGTTCACACCAGAAGGCATTGAATTCGGCACTGCAAGAGGCTGAGATGCCCC
TCGAGAAATTGATGTTGCCTGTGAAGCTGCCATGGCAGTTTGTGGGGGAAAGGTTGGCTGAGAGGGCTGTAGATTTGTTGGAGCTGCAAATTGAGAAGCC
TGTGAAGGGATGTAGGATGGTGCTCCATTCTGTGAAGGAGCCCCAGACATGCCATTAATGCCAGTCCCTGGAACTGGTTGCATAAAATTGTTTGATTGGC
CTGATGGTACAGATTGAGGCATTTGTGAAGGAGCAAATGGTGTGGCAACATTCTGAGGGATTGTAGATGGATTAGTGGCTGCAGGATGAGGTGCCTGGGA
GGAGACATAAGATGGGACTGCCTGTTCAGGGTGCACAGATGGGTTTGCAGGTGGTACCTCTGAATGTGATGAGGTGGGCACAAAAATATCTTGCTGCCCA
GGTGCAGCATTCGATCCAAAAGAGAGGTCGCCAAGAGTGTCTCCAAAACCAAAGCTTGCTGCTGAAGCAGGCTGGAAAGGATTTGCATCTGCAGCAGGTT
CAGTAGCATGGAAAGAACCAGCAGGTGCAGCATTTGTCTGAGAAACTGCAGGAGTTTCTTCATGAACAGCCTTGAAAGGCGTAGGATCCCCAAAAGGATT
AGTTGCATCAAAG