Detailed information on CNT30575084


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT001725, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30575084

Peptides detected in this lncRNA

>peptide 1 (30 aa)
VISRVLEYDWANSRVNSIEGGKNVMPRVLN*

Sequence

>CNT30575084
TGTAATATCCCGTGTTCTAGAGTATGATTGGGCGAATTCGAGGGTGAATTCGATCGAAGGGGGGAAGAATGTAATGCCCCGAGTTTTAAATTAATATATT
TCGGGGAATATTAGAGCAAACACGCAAAAGTTCAACTTTTAAACCATTGTTCGTATAGGCGATCGGGAACCGTGGATGCGTAGAGCTCGCCGAGTAGTGC
AAAATAGACTATAANTTTATAGNAATNGGAGTCCNAACNAAGTCCCGAGGATTGAATAGATGTGAGCCGTTAGATCTTATTTAGTCTCTTTATATAACCA
ACCAAAAAAAACAAAAGAAAAAAAAAGAAACAGGAGAATCGCTCCTGTAGCCCTAGCCGCCGCACCTCCTGCGCTCTGCCGCCGCCGCCGCTGTTCCTGT
CTTCGCCGGCGCCGCCGCTGGTGCAGCCGTCGCCGGTTGCCACAGCCGTCATCGTCCACAGCCGGTCGTTGGAAGGAGGGAGAGAAGGCAGAGAAGAACA
TGAAGGAAGGAAAGAAGGGGAAATTTGATAGAAGAAGGGAAATTTGGGGAATTTGGTGTGGAGGGTTCCAACGTTGGAGGAGTTGAGTCGGAGTATCGAA
GGAGTTAAGGTACCTAATGACATCGATCGGCATGGGACGGGAGTAGCACCCTTGGACTACATATTATTATTGCACACAACTGAAATTTAGTTTTAGACTA
TATTTTTTTGCTCAGCATAAGTTTTGCATAGAACTTGTAAAGGTCATTTAAGGTTCTGAGCCTTATTTTTCACGTGGGGTTTGTGGAGCTAGGATGGTTT
GGATTGTGTGGATTATATCGGTATTGACCGTTTATTTTTAGGGGAGACTTTGCCGAAATTTCTAATAATTTTAGGACTTAGTTTTTTAGTGTATTTTGGT
GTGGCATTCTAGGTACGTGGTTACCTGGGGTGTTACATTAATAGTTTTTTAGTGTATTTTGGTGTGGCATTCTAGGTACGTGGTTACATGGGGTGTTACA
TTAATAGATTTGTCTCGCAGTTTACAGGCGAAATCTGTAAATTGTTTTGTTATTAGTCTACGTTTAATACTTTAAATATGT