Detailed information on CNT30574820


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT002550, E-value = 5e-125

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30552265Oryza barthiiOryza glaberrima65.960.5296.98630forward
CNT30111334Oryza barthiiOryza longistaminata49.3785.8293.43472forward
CNT3099505Oryza barthiiOryza rufipogon48.7450.4392.92466forward
CNT30115748Oryza barthiiOryza nivara46.9754.3692.43449forward

Expression of CNT30574820

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MTASSYRLLHFAIMSLSCFRHSYNFRKVEEDV*

>peptide 2 (37 aa)
MCFTVCEHGVCESENYVFWCWCVLEMKICLMYCNLVR*

>peptide 3 (30 aa)
QPSIAEGYDGHEAVSRALSIDHLRFWATSS*

Sequence

>CNT30574820
CAGCCGTCCATTGCTGAGGGGTACGATGGGCATGAGGCTGTATCGCGTGCGCTATCCATAGACCATCTCAGGTTTTGGGCGACCTCATCCTGAAGCGCCA
TAGCCATCCCACGACCAAGCAGGCATCAAGGGTTACCGACCCGCTCGACCGGAAGCGCCGCCGCGGCAGGTGCACGGGCTACCTCCGGTGGACGTTGCCG
CCGCCGCAGTAGGGGCAAGTCGCCAACGCCGCCCTCCGCGGCCGCTGCTGCGCTCTCGTAGAGGCAAACTCTTTATGGGTGAAGATATGGCAGACAATTT
CAGGACCCTGAGGAGGAAGAGGAGTATCGTACGATTACTGCTATGAGATTCAAGACTGAGGATGACGGCTTCAAGTTATAGGCTATTACATTTTGCAATC
ATGTCTCTAAGTTGTTTTCGTCATTCCTACAATTTCAGGAAAGTAGAAGAAGATGTGTGAGATGGATAAGAAGATGCACTTTACATAGTTTTGTCATGCT
CTTGGTCCTAATGAATACATTGGACTGTAATAAATCTTGATGTGCTTTCCTGTAGTATGATGGATGTACTACTATTTTGAGTTGTGCTCGCATGGTTGAA
TTTTGATGTGTTTTACTGTATGTGAACATGGTGTATGCGAATCTGAAAATTATGTGTTTTGGTGCTGGTGCGTTCTGGAAATGAAGATATGTTTGATGTA
TTGCAATTTGGTGCGCTAAATTGTTTAGTGTATGTGAGTATGAAGTTGTGCTAGCAAATTTGGTAATTGAGCCAATATTGCTTGATATGCTTGAGACTGA
CAGCCGGATGGTTCTAATTTATTTGAGATTTGAGAAAAAAAATTGCATTCATAACAATACAGTTCGTACATAAATTATTCAACACTGGTACATATACTCC
AAGATATTGTACATAAGAATTGCAATAACAACGAGGGAACCCATGAACCAACTTTT