Detailed information on CNT30574249


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CH33|UBQ11_ARATH, E-value = 3e-127

BLAST vs NONCODE:
NONMEST001181, E-value = 5e-85

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30546269Vitis viniferaIpomoea triloba57.1463.2585.04568forward
CNT30379315Vitis viniferaManihot esculenta54.2342.6884.97539forward
CNT30165865Vitis viniferaPistacia vera56.6460.684.37563forward
CNT3032157Vitis viniferaTheobroma cacao56.8462.0983.89565forward
CNT3036185Vitis viniferaCucumis melo57.2455.483.3569forward

Expression of CNT30574249

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MVSELSTSRVIVFPVRVLTKICIPPRRRSTKCSVDSFWML*

>peptide 2 (39 aa)
MPSLSWILALTLSIVSELSTSRVMVFPVSVLTKICICFN*

>peptide 3 (44 aa)
MPSLSWILAFTLSMVSELSTSRVMVFPVRVFTKICIPPRRRRTK*

Sequence

>CNT30574249
GGGATCCCTTCCTTGTCCTGAATCTTTGCTTTCACGTTGTCAATGGTGTCGGAGCTTTCGACCTCTAGAGTAATTGTCTTTCCGGTTAGAGTTTTAACAA
AAATCTGCATTCCTCCACGGAGACGGAGCACCAAGTGCAGCGTCGACTCTTTCTGGATGTTGTAGTCAGCGAGGGTTCGGCCATCTTCCAGCTGCTTACC
AGCGAAGATCAGCCTCTGCTGGTCCGGTGGAATGCCCTCCTTGTCCTGGATCTTAGCCTTCACGTTGTCAATGGTGTCGGAGCTTTCGACCTCCAGGGTG
ATGGTCTTTCCGGTGAGGGTTTTCACAAAAATCTGCATCCCTCCACGGAGACGGAGGACCAAGTGAAGAGTGGACTCCTTCTGGATGTTGTAGTCGGCCA
GTGTTCGACCGTCTTCAAGCTGTTTCCCGGCGAATATCAGCCTCTGCTGATCCGGTGGGATGCCCTCTTTGTCTTGGATCTTGGCCTTGACATTATCGAT
CGTGTCGGAGCTCTCAACCTCTAGGGTTATGGTCTTTCCGGTAAGTGTTTTAACAAAGATCTGCATCTGTTTCAATTAAAACACCACAAAGATCAGGAAA
AAAATACAGATCTATGCAGATCTAAGGTAAAAACCCTTAAAAGTGCCAATATATTGTGACAGATCGGAACAAAGAATTCAAAAAGGCCCAAATCACAAAT
TCCCTACAATTTCTTAGGGCGTCAATAGCCGATCTGGGGAAAAACAAATAGGAAAACCTTCAAAACCGATTTACACCGGAGAAAATTTTCCTTACGAATT
CGCAAAACCAATCAATAATAGCACCATAAATCTTCACATAAAAAGAAGCTCTTAAAGAAAACAAGAAAACAAACAAACATCAAAAGAAATCCAAATTCTT
TCGGAAAAGGAAGGAGAAATTTTCTCTGAAGTACTCAATGAATTGTAAAAAACAGAAAACACAAAACATAAAAAACGAAACAAAGAAGAACCGA