Detailed information on CNT30573246


BLAST search results

BLAST vs Swiss-Prot:
sp|P56331|IF1A_ONOVI, E-value = 1e-65

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673634Vitis viniferaSetaria viridis18.2161.6888.64132forward
CNT30521379Vitis viniferaSetaria italica33.6638.8586.07244forward
CNT30616469Vitis viniferaSesamum indicum32.4131.7683.83235forward
CNT30631858Vitis viniferaVigna unguiculata28.1445.5491.67204forward
CNT30708734Vitis viniferaGlycine max33.3842.7687.6242forward
CNT30304884Vitis viniferaTriticum aestivum24.6938.8391.06179forward
CNT30474933Vitis viniferaSaccharum spontaneum31.3135.9788.11227forward
CNT3011199Vitis viniferaZea mays35.4543.0585.21257forward
CNT30718760Vitis viniferaMalus domestica golden28.4155.9884.47206forward
CNT30368761Vitis viniferaSorghum bicolor35.7214.0487.26259forward
CNT30619918Vitis viniferaCajanus cajan30.079.7892.2218forward
CNT30102311Vitis viniferaOryza rufipogon33.6636.4788.52244forward
CNT30725237Vitis viniferaLupinus angustifolius28.8339.4387.08209forward
CNT3039930Vitis viniferaMarchantia polymorpha33.3835.0278.51242forward

Expression of CNT30573246

Peptides detected in this lncRNA

>peptide 1 (64 aa)
LILKEVHYYCIEVTILIYKAEITHTVTLTFSITSNPQDRNIPSIRYPKSEKRKRKKTLADIRRE*

>peptide 2 (40 aa)
MMSPAAIQTFLCILPRMWQRRLVPSMHMASQRPLPSIRST*

Sequence

>CNT30573246
TTAATTTTAAAGGAAGTTCACTATTATTGCATAGAAGTCACCATATTAATATATAAAGCCGAAATTACCCACACCGTAACCCTAACATTCAGTATTACAA
GCAATCCTCAAGACCGCAATATTCCGTCCATCAGGTATCCAAAAAGTGAAAAAAGAAAGAGAAAAAAAACCCTCGCCGATATACGGAGAGAGTGAGCGAA
TAAAAAACCCTAGATCGGCATCTAGATTTTGTCGATGTCCTCGTCCTCGAACTCGATGTAATCGTCGCCCGCGCCTTCGTCCTCCTCGTCGAGCCTGGTG
TTCTCCGGAAGCTCACCATACGCCTTCAGAAGACGAGCCTCGTCGGGCATGTACTTGAGGATGACGTCAGCCTTGTCGTCCTGGTAATCACGAAGACCGA
CTAGGATGATGTCGCCGGCGGCGATCCAGACCTTCTTGTGCATCTTGCCTCGGATGTGGCAGAGGCGCTTGGTGCCATCGATGCACATGGCCTCACAGCG
GCCGTTGCCGAGCATACGGAGCACCTGAGCGTACTCCTGGCCGTCTTCCTTGAAGACAAGCTCCCGTTTCTCATCGTCGGCCTCGTTCTTTCCTCTCTTC
CTGTTCTTACCTCCCTTTCCCTTGTTCTTCGGCATCCTTCTCTCCCGGAAACCCTAACCCTAGATTTCTTTCGATTTCTGTTTTCGCAGACCCTAAGCTC
TCGATCTTCAAAATCTTTGGGTAAC