Detailed information on CNT30572753


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696916Vitis viniferaOryza sativa10.1140.9283.1142forward
CNT30672831Vitis viniferaSetaria viridis5.8427.6187.882forward
CNT30535317Vitis viniferaEucalyptus grandis17.0842.3381.67240forward
CNT30515289Vitis viniferaJuglans regia12.1735.783.63171forward
CNT3070359Vitis viniferaQuercus suber12.5357.781.82176forward
CNT30510806Vitis viniferaSolanum lycopersicum6.7632.8786.3295forward
CNT305922Vitis viniferaZea mays5.6921.888.7580forward
CNT30625077Vitis viniferaDaucus carota8.1933.3382.61115forward
CNT30368207Vitis viniferaSorghum bicolor6.3333.3388.7689forward
CNT30621132Vitis viniferaCajanus cajan8.921.3784.8125forward
CNT30154479Vitis viniferaPrunus persica7.3323.7387.38103forward
CNT30424411Vitis viniferaPapaver somniferum16.6529.1484.62234forward
CNT3056582Vitis viniferaAmborella trichopoda10.1122.0283.8142forward

Expression of CNT30572753

Peptides detected in this lncRNA

>peptide 1 (70 aa)
MKHKQKGLFSYSVRRKKKPKKKKTKKQKIKNKSVITTSITSYHLLQILIVKRKKIDFHDRQPKSLERQNI*

>peptide 2 (49 aa)
MIVNQNHWRDKTFDFTEADQWTKATIHSIDHRSKIPTQQQRQIFHSHKI*

>peptide 3 (35 aa)
MPNRNCKGKTKTKTESEPQRARQNQITVITTNFGA*

Sequence

>CNT30572753
GTAATAAGACAGTAATTAAGAAGAAATTTTGCTGCAACAGTTCAGCTTTGATCAGCGATCATTAAAGGGAAGACGAAAAGGATAAAAACTAGATATAGGA
AAGAGAATCAGAGAGAGACCCTGAATCAAGTAAATTCCATGCCTAACAGAAATTGTAAGGGAAAAACAAAAACAAAGACAGAATCTGAGCCCCAAAGAGC
AAGGCAAAATCAAATCACTGTGATCACCACCAATTTTGGAGCATAGAAAATTTAGTCAACCTCTTCAATCTTAGGCCCTGCACCACTGCCACCAGCAGAA
GGGCCATCATCGTCCATGGCACCAGCGCCCGCATCAGGACCACCAGCACCCTGATACATCTTTGCGATAATGGGATTGCAGATGCTCTCCAGCTCCTTCA
TCTTGTCCTCAAACTCGTCTGCTTCTGCAAGCTGGTTACTGTCCAACCATTGAATGGCCTGTTCAACAGCATCTTCAATTTTCTTCTTGTCTGCTGGGGG
AAGCTTGGCACTGTAACAACAGCGTTCTTCACAGTTGAACCGAGGTATGCCTCGGCAATCTCACGCATCTTAATCAGAACCATGGACGAGATTTCCTCGG
CGGCAAACTGCTTATCTTCACCCTTATAGGTGACTGTGATCATGGGCTTGTCACCAGGACCAGGAACGACCTTGAATGACCAGTGCTTGATATCACTCTG
AACCGAGGCATCAGAGAATCTTCTACCAATCAAACGCTTGGCATCTGCAATCCATAAGATCAAACTATTAAATCAGGAACAAGATCAAAAGAGTTTTTAA
TCTGATTCTAGACGAATTCAAATTTTCAATCACATAAAACAGGATCCAAGATAAGAGTTAAAAAAACCTAACAATTAAACAAATAAATAAACCTTAATTT
TAAATAATAAAAAAATAATTTTAAAAGTAGCATGAAACATAAACAGAAAGGGCTGTTTAGTTACAGTGTTAGACGGAAAAAAAAACCAAAAAAAAAAAAA
ACAAAAAAACAAAAAATCAAAAACAAATCTGTAATCACCACATCGATAACCTCTTATCATCTGCTTCAAATATTAATTGTCAAACGAAAAAAAATTGACT
TTCATGATCGTCAACCAAAATCATTGGAGAGACAAAACATTTGATTTTACAGAAGCAGATCAATGGACCAAAGCAACCATACATAGCATAGATCACAGAT
CCAAAATCCCTACACAACAACAACGACAAATTTTCCATTCACACAAGATCTAAAATCCAAATCTCATATCCATTCCTATTAGATCTAAAATTCACATTTT
GATTCTTATAGGATCCACCCTGAAAACGAAATCTTATAAATCAAAGAATGGCAAACAAAGCTTCTAATACAAGATCCAGTCGGAACCACAAAAACCAAAA
CAAAA