Detailed information on CNT30572543


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30572543

Peptides detected in this lncRNA

>peptide 1 (42 aa)
MIYFLLPTLEDILLPVCLNLGSCAIDNYWKEQLVLVYWNCQN*

Sequence

>CNT30572543
CAGAAGATATGGTATATGAGTACTAAATTTGAAGCAGCTGAAGGCCAAGATGATATACTTTCTTCTCCCAACACTTGAAGACATTCTACTTCCAGTATGC
CTGAATCTGGGGTCATGTGCAATCGATAATTACTGGAAGGAACAGCTGGTGCTTGTTTATTGGAATTGCCAGAATTGATTAGATAGTTGTTGGATCTTCT
GCTTCTGAGTTGGATCCTGAGCAGGATCTCAGTACAGTAGTTTGGACAACAGATGAGTTGACAGAATCTTGTGATG