Detailed information on CNT30572175


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONCQUT004405, E-value = 2e-154

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30572175

Peptides detected in this lncRNA

>peptide 1 (34 aa)
LQLFVFHKSKNFTSDYEIRMSLTILLNHYYDPKG*

Sequence

>CNT30572175
TTGCAGTTATTCGTCTTTCATAAATCCAAGAATTTCACCTCTGACTATGAAATACGAATGTCTCTGACCATCCTTCTTAATCATTACTATGATCCCAAAG
GCTAACAGAATATGACCAAAATCATATGATGTTATCCCATGCTAATGTATCCAGAGCGTAGGCTTGCTTTGAGCACTCTAATTTCTTCAAAGTAACAGCA
CCAAAGGCACAACCCATCCAATTAAGGCTAGGAGCACATCGCCGGTAGAAGGGACGAGGCGACAGGTGCACACCGCGAGGCGGACCGGTCGACCCATCCC
AAGGTCCAACTACGAGCTTTTTAACTGCAACAACTTAAATATACGCTATTGGAGCTGGAATTGCTGTGACTATTGGCACCAAACTTTCCCTCCAATGGAT
CCTTGTTAAGGGATTTAGATTGTACTCATTCCAATTACCAAACTGAAAGAGCCTAGTATTGTTATTTATTGTCACTACCTCCCCGTGTCAGGATTGGGTA
ATTTGCATGCCTGTTACTTTGG