Detailed information on CNT30571087


BLAST search results

BLAST vs Swiss-Prot:
sp|P62981|RS27A_SOLTU, E-value = 3e-64

BLAST vs NONCODE:
NONPOPT001132, E-value = 3e-39

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30316655Vitis viniferaCorylus avellana32.1367.6290.61213forward
CNT30545885Vitis viniferaIpomoea triloba32.4347.3689.77215forward
CNT30518633Vitis viniferaJuglans regia55.3585.7585.83367forward
CNT30628786Vitis viniferaVigna unguiculata32.8844.4989.91218forward
CNT30164510Vitis viniferaPistacia vera63.541.8186.22421forward
CNT30435385Vitis viniferaAegilops tauschii58.9767.5385.93391forward
CNT30623440Vitis viniferaDaucus carota32.4310.889.77215forward
CNT30580001Vitis viniferaEchinochloa crusgalli58.9753.5685.42391forward

Expression of CNT30571087

Peptides detected in this lncRNA

>peptide 1 (51 aa)
MRRCWSGGMPSLSWILAFTLSMVSEDSTSRVMVLPVRVFTKICIFASGEEG*

>peptide 2 (92 aa)
MKSETAPSLSLTTGLLVNISQTTLTAIVTVKVVGHESAGATLSVGALLPQPLDLAGVINLVELQHGELHLLLLVLDLLGRSTRWRVDSFWML*

Sequence

>CNT30571087
ATTTTGAACTCCAAAACTGTGACTTTAAAGTATCATAAAGCATAACAAAACATGATAAATCCACCAAACCAAGTCCTAAACCTCATTATTGGTCTCAATA
TCCTAGAGCAAAGATGAAATCAGAGACGGCGCCATCTCTCTCACTCACCACCGGCCTTCTGGTAAACATAAGTCAAACCACACTTACCGCAATAGTGACG
GTCAAAGTGGTTGGCCATGAAAGTGCCGGCGCCACACTCAGCGTTGGGGCACTCCTTCCTCAGCCTCTGGACCTTGCCGGAGTCATCAACCTTGTAGAAC
TGCAACACGGCGAGCTTCACCTTCTTCTTCTTGTGCTTGATCTTCTTGGGCGGAGCACCAGGTGGAGGGTAGACTCCTTCTGGATGTTGTAGTCAGCTAG
GGTCCGGCCGTCCTCGAGCTGCTTCCCGGCGAATATGAGGCGTTGCTGGTCCGGAGGAATGCCTTCCTTGTCCTGGATCTTGGCCTTCACATTGTCGATG
GTGTCAGAGGACTCCACCTCAAGGGTTATGGTCTTACCCGTTAGGGTTTTCACGAAGATCTGCATCTTCGCGTCAGGGGAAGAGGGGTAAGGATTAGGGT
TTCTAGGGTTTGGATGTAGTTGCGACTCGCTAGGTTAAAAGAGAGCCCATATTAGGGTTTCAT