Detailed information on CNT30570407


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9M8S0|MBS1_ARATH, E-value = 5e-32

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30687535Vitis viniferaTriticum urartu4.853.8281.07169forward
CNT30348261Vitis viniferaEragrostis tef2.2727.598580forward
CNT30102338Vitis viniferaOryza rufipogon5.3429.6182.45188forward

Expression of CNT30570407

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MDRKTSLDMDIQEVQAFTQEISIHFQVGTMS*

>peptide 2 (34 aa)
MLVRGAYAPTYIISCHLANISHTKKGAKYRRSIS*

>peptide 3 (35 aa)
MWSSLVIPCEVGLLMTWPLEAHSCVLRYIYFLGAH*

>peptide 4 (36 aa)
MASFEVLNFQVHYHSNKTYFTSYHLSFNTPHVHSTI*

>peptide 5 (38 aa)
MHLQKCISLVVAIHKKPLMEHHVSGSFGFFPILGHVTT*

>peptide 6 (38 aa)
MASGSAFMCSTVYIFFRSTLAQKNFDRHKKKSANTCSY*

>peptide 7 (38 aa)
MHFKTIFTDLREEEGKQCLGDTCRDKWIYNMIEHSPHS*

>peptide 8 (54 aa)
MYIQQFNMLPYKITLSLQFPFVPNFLFGGEKEKKVEGQNDIGLCRYIVLAHHMN*

>peptide 9 (66 aa)
MRWFHSLRDLVREVKSCNFLNNQDIFQPNQTGGSTHLFVVVDFPTKVRLASAFSTLVGSYSKQPSS*

>peptide 10 (88 aa)
MSPELLNAQGIITPLLQYEKDAPLSQLCPLMESVKGSLFLNDQSPKLRKQLYLHESSLNMLSRQHPTINIIELVEGKVQKVLYCMDFL*

>peptide 11 (30 aa)
MSKVNAYILKWIGKLPLTWTYKKSKLLHKK*

Sequence

>CNT30570407
CCTTACTGTATTATGCACAACAAAAACAATATATTAACTAGCATTGCCAAATCCATGATTTCATCAACTACATTCTGATATTTTGTTTTTCCCTGATAGG
CCAACAACATACTGATAAACCTTCGGGTCATTATTTCCATTTCTCAAACACACCACATCACCAGAATCAACTTCAACTACATGAGAATTCCTTGTGGGGT
GATCACAGTCACATGTCAACCAGACAACCCATCAACGATTCCCTGATTAGAGTCTTCAAGATACCGTCAAAGGCTATATAGGCTGGCTCCCAGCAGTGTA
TCTGTGCTCATAAAATCCACTAAACAGGTAAATGTTGAGACTAGAGTTTTGATGAAATTAAATTAATAAAACATAATATTCAAATGACGTACTCATTATA
AAACCCACAAAATGAACTAAACTATAACTATAATCTTAAGTTCCAAGTTCAAGTTCAAGTTCTGCCCAAGTAAGAATATCTGTATTATCTTCTGGTGGTC
ATGCGAGTATGGCTTCATTTGAAGTTCTAAATTTTCAAGTTCATTATCATTCAAATAAAACCTATTTCACTTCATATCACTTGAGCTTCAATACTCCACA
TGTACATTCAACAATTTAACATGTTGCCATACAAAATCACTCTCTCTCTCCAATTCCCATTTGTTCCCAACTTTTTATTTGGAGGGGAAAAAGAAAAGAA
AGTGGAAGGACAAAATGACATTGGACTTTGTAGGTATATTGTTTTGGCACACCACATGAACTAATATATGATCACCACACATGTAATTAGCATGACACTT
TAACTCATTCGAAACATGGTCAATTCATCAAGCAGCACAATTCATAAAGCTCCATGATCCAGGTCTACTAGTAGTTGACCCTATATACATATATACACAT
GCAAAACAAAAATTCATTACTAACAAGTTAGAAGTACAATTTATGGCCCCCCTAATATCTTCATGGATTTCTCTCATTTATGTCACCTGAGCTTCTGAAT
GCACAAGGAATCATAACTCCACTTCTCCAATATGAAAAGGATGCCCCTCTATCTCAGTTATGCCCTCTAATGGAGTCAGTGAAAGGTAGCTTATTTCTCA
ACGATCAATCTCCAAAACTCCGAAAGCAGCTCTATCTCCATGAATCATCATTGAACATGCTTTCTAGACAGCACCCTACCATTAATATTATTGAGCTAGT
TGAAGGCAAGGTTCAAAAGGTCCTATACTGCATGGACTTTCTATGAGGGGACTAACCTTTCAACTTCCAAAACCTTGGGATTGACATGGAGCCTTTGGCT
TTACAAGAGGCTCACAAAAAGTAGGAATATACCATATGCATTTCAAAACCATCTTCACTGATTTGAGAGAAGAGGAGGGTAAACAATGTCTGGGGGACAC
ATGTCGAGACAAGTGGATTTACAACATGATAGAGCATTCACCTCACTCATAATGTACCTATGAGCAAGGTGAATGCCTACATCCTGAAATGGATAGGAAA
ACTTCCCTTGACATGGACATACAAGAAGTCCAAGCTTTTACACAAGAAATAAGCATCCACTTCCAGGTTGGCACCATGTCCTAGTAGGACAGAAAGAGGT
CATGGCTATTAGAGCCACATAAAGATGAAATGACATGTGGAGCTCATTAGTAATCCCATGTGAAGTGGGGCTACTAATGACATGGCCTCTGGAAGCGCAT
TCATGTGTTCTACGGTATATATATTTTTTAGGAGCACATTAGCACAAAAAAATTTTGATAGGCATAAAAAAAAAAGTGCTAACACATGCTCCTATTGAAT
ATATATTCTGTAGAACACATGTAGCCCACAAAGCATGTAAAGTCTATGCTAGTAAGAGGGGCATATGCACCAACCTATATCATATCATGCCACCTTGCTA
ACATAAGCCACACAAAGAAAGGAGCTAAATATCGGCGTTCAATTTCATAGTGACACTTAGACCTACAATTTTTTGACATGTATCCATTATGATGTAAAGG
CCAAGTGGCACATAGATGCACCTCCAAAAATGCATATCATTAGTAGTTGCAATTCATAAAAAGCCATTGATGGAGCATCATGTGTCAGGATCTTTTGGTT
TCTTTCCCATACTAGGACATGTGACAACCTAGTGGGATTGTTTGGATGTCCTATGGTGAACGCCAAATAAAATTCTCCCATACATCTCACGATGGAAGCA
TTTCACCTTGCTTAAAATGCAAATGAACGAGTCACCTCAACATGTTAATTGAGCAATGGTTGGTTTCTCCCCAACATTTACTAGTTGACTTTACCAGTTC
CTTCCCACTCTCATGAACAGGGCAACCCCTTGGAAGGGGCAAGGGCCTAAGCCCATCCTTACTGAGATAAATACATCTCCTGCCTTTCCAAGGGCATAGG
AATACAACACTGATATACGTTATACCTCCCCACATCAAGCGTGAAGCTCGAAGAACTCAAAAGGGCTTGATGTACCTAAGTGGCATGCTTGACCTGCTTT
ACTATTGAGCATATGAGATGGTTTCACAGTTTAAGAGACTTGGTTAGAGAAGTTAAGAGTTGCAACTTTTTAAATAACCAAGACATTTTTCAGCCAAATC
AAACTGGAGGTTCCACACATCTTTTTGTTGTGGTTGATTTTCCTACCAAGGTCAGATTAGCTAGTGCCTTTTCTACCCTAGTTGGCTCTTATTCAAAACA
ACCCTCTAGCTAACAGGAAACACTGCAAAGATGGATTCTGATTTTCCTTGAATTAGAAAAAGCCTCTAGTTCAGAAACCCGTCCTCTGCATTCACCACTC
CAGAACATTCAACTGCGGAAGGGCCTCCTACATCCCCTCCCGTCCTCCTCTACGATTTCCAGAAATCGAAACATCAAACTAAAGGAATCCCAAGCCCTAA
ACACAAACCTATCAACCAGATCTTTTGCTCATCAACAAGAACAATCCCACAACCTTTTCTTAACCATCAACAGAAGAAAAAAATAAAAATTTGCGGAGCT
AAAGTACTCATATTATCATTATTCATATGATCCATAACACCACACTATTCCCACCTAAAGGATCATCACCACGTCTAATATACACACCATAACAACGCTT
CATCACATCTCATAGATCCTAATCACCATCACCCATATCGATAAGCCACAGGACACAACATCGAACAGGAAAAAAAAAGTTCGAAATCAGAGAAGCAAGA
ATTACTTCTTGAAGCTGCCACGAACCCCAGGGCGAGCTTCGTGGTGGATTTGCATCGATTTGAGGTCGGGAGCGGTGATTTTGCAGAGAGGGCACTCGAG
CTTAGCGTGGCCGCCCTTGTCGAGGCCGGAGCGGTCTGCTTGGCCGGCCTTGCCTCCGCCACGGTTGGTGGTGGCGGCGTCGACCTTAGCGGCGATCTCC
TTCGCCGTGTGCTTCTTTGGTTTCGCTTTTCCGGTCATGCTCGGAGGTCGGCGGTCGGCGGTCGGCGGTCGGTGGCTGATCGATATCAGAGGGGAACCCG
AACCCAAACCCTAGGTTTTCTT