Detailed information on CNT30569841


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9SSK7|MLP34_ARATH, E-value = 1e-17

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30569841

Peptides detected in this lncRNA

>peptide 1 (42 aa)
NGVTPMLDGALSLPVTFMYLDFVYFIGADIRKVGGYGLGVTH*

>peptide 2 (78 aa)
MGIWATLTCLLIFDGPYHQAALPLWYRLCGELVALVVFQHLPIQNLECDGPVFFIYLIHSLFNTLRILSYSCSLSAPPH

Sequence

>CNT30569841
CCAATGGTGTAACTCCAATGCTTGACGGAGCCCTGAGTCTCCCAGTCACCTTCATGTACCTCGATTTTGTGTATTTTATCGGAGCAGATATTAGGAAGGT
GGGTGGATATGGCCTTGGTGTTACGCATTGAGAAGGTGACTTTCGATATCTTTGGTGATATTAACTGAAAACTCTAGGCAGTTATGGGGATCTGGGCCAC
CCTCACTTGCCTTCTCATATTCGATGGTCCATATCACCAAGCAGCCCTCCCCCTTTGGTATCGCTTGTGTGGTGAACTTGTAGCTCTTGTAGTCTTTCAG
CACCTCCCCATCCAAAACCTTGAATGTGATGGACCTGTTTTCTTCATCTATTTGATCCACAGTCTCTTTAATACTCTCAGAATTCTCTCCTACTCTTGTA
GTCTTTCAGCACCTCCCCAT