Detailed information on CNT30569398


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30678637Actinidia chinensisSetaria viridis19.6594.5894.79384reverse complement
CNT30524663Actinidia chinensisSetaria italica23.1377.6690.93452forward
CNT30641615Actinidia chinensisNymphaea colorata23.0881.4196.9451forward
CNT30549212Actinidia chinensisIpomoea triloba34.4422.3197.77673forward
CNT30513456Actinidia chinensisJuglans regia36.7522.6297.91718forward
CNT30272552Actinidia chinensisChenopodium quinoa51.3379.7393.121003forward
CNT30730518Actinidia chinensisCorchorus capsularis42.3783.9897.1828forward
CNT30630109Actinidia chinensisVigna unguiculata32.4520.1197.32634forward
CNT30196906Actinidia chinensisPisum sativum16.9943.8697.89332forward
CNT30294119Actinidia chinensisTriticum aestivum14.02100.3795.62274reverse complement
CNT30220355Actinidia chinensisHordeum vulgare14.5394.9896.48284forward
CNT30396824Actinidia chinensisTriticum turgidum32.9163.8591.6643reverse complement
CNT30511593Actinidia chinensisSolanum lycopersicum20.8862.6790.93408forward
CNT30552690Actinidia chinensisOryza glaberrima33.9843.3791.57664forward
CNT30442196Actinidia chinensisAegilops tauschii31.0671.5892.42607reverse complement
CNT30657980Actinidia chinensisTriticum dicoccoides20.5798.5395.02402reverse complement
CNT30460907Actinidia chinensisSaccharum spontaneum33.9819.9392.47664forward
CNT3017993Actinidia chinensisZea mays33.9835.2892.47664forward
CNT30607450Actinidia chinensisGossypium raimondii17.2522.7185.16337forward
CNT30207763Actinidia chinensisHelianthus annuus30.2563.7598.98591forward
CNT30688674Actinidia chinensisTriticum urartu33.7850.1192.27660forward
CNT30720843Actinidia chinensisTriticum spelta10.2493.0286200forward
CNT30347837Actinidia chinensisEragrostis tef32.8683.2791.59642reverse complement
CNT30363261Actinidia chinensisSorghum bicolor22.2134.0990.32434forward
CNT30620564Actinidia chinensisCajanus cajan34.7513.1297.5679reverse complement
CNT30354697Actinidia chinensisLactuca sativa13.9238.5398.9272forward
CNT30481523Actinidia chinensisChara braunii3.3327.0895.3865reverse complement
CNT30410483Actinidia chinensisPapaver somniferum73.9570.6394.261445forward
CNT30642274Actinidia chinensisCannabis sativa31.9976.592.64625reverse complement
CNT30319706Actinidia chinensisAsparagus officinalis22.2115.198.39434forward
CNT3036965Actinidia chinensisCucumis melo34.6592.9998.67677forward
CNT30331560Actinidia chinensisDioscorea rotundata16.4863.7693.17322reverse complement
CNT30148090Actinidia chinensisBrachypodium distachyon33.9822.8692.32664reverse complement
CNT30104374Actinidia chinensisOryza rufipogon33.985091.11664reverse complement
CNT30497700Actinidia chinensisDigitaria exilis12.2843.8892.92240reverse complement
CNT30604015Actinidia chinensisOryza punctata23.896.2790.97465reverse complement
CNT30174498Actinidia chinensisVigna angularis20.3278.6196.47397forward
CNT30551087Actinidia chinensisOryza brachyantha15.4101.0188.04301reverse complement
CNT30115272Actinidia chinensisEutrema salsugineum25.49102.4788.76498forward

Expression of CNT30569398

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MIGITGQKLWNLGVGLLSKWNGLTFSFYLSLMVE*

>peptide 2 (71 aa)
MFQGLGCSPIKAVRELGSERRETVRSISGVGVRALRGPFPSTRGPGRTHLWCTSYRAHGKRWVAKCGADNC*

>peptide 3 (55 aa)
MKKPKALPSLSIYPRDGRAEAFGGPLQSRIGASQSLANMLFSHAFLRSWFDILVS*

>peptide 4 (33 aa)
MTRSIRSGTRHLFSLFNSLTTRKNKPLFNYLTT*

>peptide 5 (38 aa)
MELGCGSFVEMEWPYFFFLFIVNGRIITHSMPGPSAYFF

>peptide 6 (42 aa)
MREAPQRYVIPAKAAHPTIQSCPTLHLERAKDDNPVVRGEFS*

>peptide 7 (46 aa)
VHVPTCATWPFVHMNLISPPNNRRPRISPSPPPSEIVPPRQPRLTR*

>peptide 8 (43 aa)
MVRYSGVLGVEEPHQSIPNLVVKLYCGDDTVGEVLRKNSSTPG*

>peptide 9 (32 aa)
MKKKKNEKVVLFKTPIMTSLLSHFTPRNAPFL*

Sequence

>CNT30569398
GGTACATGTGCCAACTTGTGCCACGTGGCCCTTTGTTCACATGAATCTCATCTCACCACCTAATAACCGTAGACCACGTATCTCACCATCGCCTCCGCCA
AGTGAGATTGTGCCTCCAAGACAACCTAGGCTTACGCGCTAGGACCCACTCGGTATCACTGGAGATGAGGGATCGTCAAGGTTGCTTGATTCCCAATCCA
CCTTGGCTAGTCTTAGACAGTTAGATGAGAGAGGCTCCGCAGAGATATGTGATACCTGCAAAAGCAGCACACCCGACAATACAATCATGCCCGACACTGC
ACTTGGAGCGTGCGAAAGATGATAACCCTGTTGTACGAGGAGAGTTCTCATGACATCCCTTGATATTGTCGGGTGATGCAGTGGTATGAGGAGATTTTTC
AACGGCAGCTAATATGTCAGGCAGTGTGCTAAAAAGCGCTAGGCAGTAAGCGGGCGGCCGGGGGTGTCGAGTGGAAGGGCCGTTGCTCAACGGATAAAAG
TTACTCTAGGGATAACAGGCTGATCTTCCCCAAGAGATCACATCGACGGGAAGGTTTGGCACCTCGATGTCGGCTCTTCGCCACCTGGGGCTGTAGTATG
TTCCAAGGGTTGGGCTGTTCGCCCATTAAAGCGGTACGTGAGCTGGGTTCAGAACGTCGTGAGACAGTTCGGTCCATATCCGGTGTGGGCGTTAGAGCAT
TGAGAGGACCTTTCCCTAGTACGAGAGGACCGGGAAGGACGCACCTCTGGTGTACCAGTTATCGTGCCCACGGTAAACGCTGGGTAGCCAAGTGCGGAGC
GGATAACTGCTGAAAGCATCTAAGTAGTAAGCCCACCCCAAGATGAGTGCTCTCCTATTCCGACTTCCCCAGAGCCCCCGGTAGCACAGCCGAGACAGCG
ACGGGTTCTCTGCCCCTGCGGGGATGGAGCGACAGAAGTCTTGAGAATTCAAGAGAAGGTCACGGCGAGACGAGCCGTTTATCATTACGATAGGTGTCAA
GTGGAAGTGCAGTGATGTATGCAGCTGAGGCATCCTAACAGACCGGTAGACTTGAACCTTGTTCCTACATGACCCGATCAATTCGATCAGGCACTCGCCA
TCTATTTTCATTGTTCAACTCTTTGACAACACGAAAAAACAAACCATTGTTCAACTATTTGACAACATGAAAAAACCAAAAGCTCTGCCCTCCCTCTCTA
TCTATCCAAGGGATGGAAGGGCAGAGGCCTTTGGTGGTCCCCTCCAGTCAAGAATTGGGGCCTCACAATCACTAGCCAATATGCTTTTCTCTCATGCCTT
TCTTCGTTCATGGTTCGATATTCTGGTGTCCTAGGCGTAGAGGAACCACACCAATCCATCCCGAACTTGGTGGTTAAACTCTACTGCGGTGACGATACTG
TAGGGGAGGTCCTGCGGAAAAATAGCTCGACGCCAGGATGATAAAAAGCTTAACACCCCTCATTCTTATTACTTTTTCAATATGAAAAAGAAAAAAAATG
AAAAGGTCGTCTTATTCAAAACCCCAATCATGACATCCCTTCTCTCCCACTTCACACCTCGGAACGCACCGTTCTTATAGAGATAAACGCGCTTTCACAT
CTTCTTAACCCGAAATGGCTGGGGAGAGGAAAGGTTCCTTTTTTTGAGTGAGGGTACTCCCGGGAACAGATCCAGTGGAGACGGGGCGGGGCCTGTAGCT
CAGAGGATTAGAGCACGTGGCTACGAACCACGGTGTCGGGGGTTCGAATCCCTCCTCGCCCACAACCGGCCCAAAAGGGAAGGACCTTTCCCTCTGGGGG
TAGGAAAATCATGATCGGGATAACGGGCCAAAAGCTATGGAACTTGGGTGTGGGTCTTTTGTCGAAATGGAATGGCCTTACTTTTTCTTTTTATTTATCG
TTAATGGTAGAATAATTACACATAGTATGCCCGGCCCATCAGCGTATTTTTTTT