Detailed information on CNT30568992


BLAST search results

BLAST vs Swiss-Prot:
sp|Q93ZY2|ROGF1_ARATH, E-value = 2e-13

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30568992

Peptides detected in this lncRNA

>peptide 1 (71 aa)
MWFFSPSATRPLTLPPHCERLAFRCFYVSSGLSASTHIQLPQSCLPHLACDTLMTDPGNQEDNLLRIAQQL*

Sequence

>CNT30568992
TGCTCAGGAGTAGTAAAAAAAATACCTTGTTGTACTGAATTTTGATCATATCCAACACAATCTTTGGGAGGTCTTGGAAACGAAGTCTCAAGCTATGTAA
TAGGGTCTCAGCTTGTTGTGCCAGAATGTGGTTTTTCTCACCATCAGCGACAAGGCCCTTAACCTTACCTCCCCATTGTGAACGCTTAGCTTTCAGGTGT
TTCTATGTTTCCTCCGGTCTTTCTGCTTCCACACATATACAGCTGCCTCAATCCTGTTTGCCACATCTAGCGTGTGATACTCTGATGACAGATCCAGGCA
ATCAAGAAGACAATCTGTTGAGAATTGCTCAGCAGTTATGAGGCGACAGATGTTAACACCTAAACAAGCTTTTCCACTCAGCAATGGTAATTGAAAA