Detailed information on CNT30568322


BLAST search results

BLAST vs Swiss-Prot:
sp|Q8W171|CYP1_SOYBN, E-value = 5e-65

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30671343Actinidia chinensisSetaria viridis34.9322.7882.44131forward
CNT30640933Actinidia chinensisNymphaea colorata38.671984.14145forward
CNT30517653Actinidia chinensisJuglans regia36.87.2186.96138forward
CNT30618033Actinidia chinensisSesamum indicum31.7314.7385.71119forward
CNT3071229Actinidia chinensisQuercus suber37.619.1188.65141forward
CNT30198931Actinidia chinensisPisum sativum20.5322.7187.0177forward
CNT30710754Actinidia chinensisGlycine max33.3348.0888.8125forward
CNT30128639Actinidia chinensisCorymbia citriodora33.625.5684.13126forward
CNT30722480Actinidia chinensisTriticum spelta45.630.1682.46171forward
CNT30429993Actinidia chinensisPapaver somniferum32.812.281.3123forward
CNT30100563Actinidia chinensisOryza rufipogon41.616.782.05156forward
CNT30575409Actinidia chinensisOryza barthii41.625.1281.41156forward

Expression of CNT30568322

Peptides detected in this lncRNA

>peptide 1 (90 aa)
PLGLVGADEKLRSVGPGTGVRHRQDPWPGVLLDEVLVGELGSVDGLAAALVVQGLSAPSDALLAGAESAEVLSGAGSGVGVQLHYDPADR*

>peptide 2 (28 aa)
MSKNTLGFAIISDSLSLSSLCVALSTTLS

>peptide 3 (42 aa)
HSVLSVQMKNCDPLVPGPAFAIDRIPGPVCFLMKFSSANLDP*

Sequence

>CNT30568322
CCACTCGGTCTTGTCGGTGCAGATGAAAAACTGCGATCCGTTGGTCCCGGGACCGGCGTTCGCCATCGACAGGATCCCTGGCCCGGTGTGCTTCTTGATG
AAGTTCTCGTCGGCGAACTTGGATCCGTAGATGGACTCGCCGCCGCCCTTGTAGTGCAGGGGCTTTCCGCTCCGTCCGACGCCCTTCTCGCCGGTGCAGA
GAGCGCGGAAGTTCTCAGCGGTGCGGGGAGTGGTGTCGGCGTACAGCTCCATTACGATCCGGCCGACCGGTGAGCCGCCGACCGACATGTCGAAGAACAC
CTTAGGGTTTGCCATTATCTCAGATTCTCTCTCTCTCTCTTCACTGTGTGTCGCTTTGTCAACTACACTCTCCAC