Detailed information on CNT30568235


BLAST search results

BLAST vs Swiss-Prot:
sp|P46293|RS16_GOSHI, E-value = 4e-48

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30515426Actinidia chinensisJuglans regia76.5917.4387.77229forward
CNT3043803Actinidia chinensisPrunus dulcis33.7819.2788.12101forward
CNT30391876Actinidia chinensisTriticum turgidum32.4443.383.5197forward
CNT3083687Actinidia chinensisVigna radiata71.5722.587.38214forward
CNT30555564Actinidia chinensisOryza glaberrima78.653.0579.57235forward
CNT30232050Actinidia chinensisAnanas comosus70.918.6188.68212forward
CNT30625853Actinidia chinensisDaucus carota66.8915.5885.5200forward
CNT30120766Actinidia chinensisCitrus clementina63.2134.9484.13189forward
CNT30151249Actinidia chinensisBrachypodium distachyon28.4316.3185.8885forward
CNT30104226Actinidia chinensisOryza rufipogon78.9349.3780.08236forward
CNT30176592Actinidia chinensisVigna angularis73.5826.9988.64220forward

Expression of CNT30568235

Peptides detected in this lncRNA

>peptide 1 (85 aa)
LLIEGDEGLGDALADGVDLGGVPAAFDADAHVNAGEALAAKEEDRLVRLVAEDLRLHQLDRAAVDLDQTATALAVGDGSVVSEKT*

Sequence

>CNT30568235
ACTTCTGATAGAAGGCGACGAGGGCCTTGGCGATGCTCTGGCGGATGGCGTAGATCTGGGAGGTGTGCCCGCCGCCTTTGACGCGGATGCGCATGTCAAC
GCCGGCGAAGCGCTGGCGGCCAAGGAGGAGGATCGGCTCGTACGCCTTGTAGCGGAGGATCTCCGGCTCCACCAGCTCGATCGGGCAGCCGTTGATCTTG
ATCAGACCGCGACCGCGCTTGCAGTAGGTGACGGCTCTGTGGTCTCTGAAAAAACCTAACCCTGGATCGTTCCAAAGAAAATGAAATGTTTGGGAGGCG