Detailed information on CNT30567615


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30567615

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MLVMHYCIDILYCWISIMNGLSVSFFMSLIIYCEHVNY*

>peptide 2 (76 aa)
MLIISSHPHRLFLTGEVIQLSVWFTVVTILDVVIFLVKVGVLSRTRGSSRFCTLLICLELGCTSVLCLKRVCLYSV*

>peptide 3 (49 aa)
MVILYEMMWQCISFMLCACIALEKVNHGGLTRNVSVGALLEGCVSRGTP*

Sequence

>CNT30567615
GTTAAAGTAAAAGAAAGAAGAGAGAGAAGAAATTGAAAGAAGAGAAACCGAGAGAGAGACCGAGAGGGCGGAAAATCAAACATTTCTTGGCGGAGCAACC
AATTGAGAGAGGAATTAAGGAAGGAGAAGGGCCTTCAAAGCAACCTCAGGCGTGACTTGACTGTGGTGTGAGTACGGTGACAGGTGGGAAATAAAATATA
TGATAATCTTATTCATATTGAATTACTTGCCTCTTACATAATTGATGATGATGATGATGTTTCTATCTATGAGGTGATATATTTGAAGTGATTATGGTGA
TTCTATATGAGATGATGTGGCAATGCATATCATTTATGTTGTGTGCTTGCATTGCATTGGAAAAAGTTAACCACGGTGGGTTAACTAGGAATGTGTCAGT
AGGGGCACTACTTGAGGGATGTGTCAGTAGGGGCACTCCTTGATAACAAACCAACAAATATTGGGCCAACGTTATCTAAACTTGCGCGCATATGTTGGTG
ATGCATTATTGCATAGACATTCTTTATTGCTGGATTTCCATAATGAATGGCTTATCTGTATCATTCTTTATGAGTTTGATTATTTATTGTGAGCATGTTA
ATTATTAGCTCACACCCACATAGACTTTTTTTGACAGGTGAGGTGATACAGTTATCTGTCTGGTTCACTGTGGTTACAATCCTAGACGTGGTGATCTTCC
TAGTCAAGGTTGGAGTCTTAAGTAGGACTCGGGGTAGTTCTCGCTTTTGTACACTTTTGATTTGTCTTGAGTTGGGTTGTACATCTGTCTTATGTTTAAA
GAGAGTATGTTTGTATTCAGTCTAGATGTGTGTATGTATGACTATCTTGTGGTTTG