Detailed information on CNT30566682


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30566682

Peptides detected in this lncRNA

>peptide 1 (41 aa)
MHEHIKRSILTVGSVSMTLEIGAMEACLMFRKCPKCVSSSF*

>peptide 2 (45 aa)
VNVESCGVVIFNYSRFSSLMRRLRILMINTGHCLQRSDIMSFECD*

>peptide 3 (37 aa)
MSDESIVMLKRRIINKIYAGRCMSILKDQSSLSDLCR*

Sequence

>CNT30566682
AGGTCAATGTAGAAAGTTGCGGAGTTGTGATTTTTAATTATTCAAGATTTTCCAGCTTAATGAGAAGATTGAGAATATTAATGATCAATACTGGACATTG
CTTGCAAAGGAGTGATATTATGTCCTTTGAGTGTGACTGATGGGGTTGGGTATCAGAGATGGCTAACTTTGCTCCAAAACTATGAGTGACGAGTCCATTG
TTATGTTGAAGAGAAGGATCATCAACAAAATCTACGCAGGAAGATGCATGAGCATATTAAAAGATCAATCCTCACTGTCGGATCTGTGTCGATGACTCTA
GAAATTGGGGCCATGGAGGCATGTTTGATGTTCAGGAAGTGTCCCAAGTGCGTATCGTCTAGCTTCTGAATTGAAGGACCTTCAGGTCGTTGAAGTCAGC
ACCGAGCTTCCCGAGCAATTCTGATTGTTGATTGCTTATCCCAGATTTCTACCACAACAATTTTAATATTTAAACAATTCTTTTTTAGATAGGATATTAA
TTGAGAATATTGATACAAATTTAATAATCAAAAGGACCAAATCAAAGTAATTTAAAATTTAAGAGTCAAAATGATAATTTACTAATAATATTAGGAAACA
AAGCGCATTACTTGTTTATTAAGTTTCTTTGGAAGACTTTCCAAAGCCTTTCAGAAATGAAGAAAAAAATTTAAGAAAAGGGTTGGGATGTCTAAATCAC
ACAGTCAATTCATTAAAATTGGAAAGAAGATGGCATCCAATGGGGCACACTTATGGACACCTTGCAATTGACCACAAGCAGGCAATTGATC