Detailed information on CNT30566047


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30566047

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MKYECPRLSLLIITPIPKANRIGSKSYDVIPC*

>peptide 2 (41 aa)
MSPVLLFIVTTSPCQDWVICAPAAFLGCGSRFSGSLSGIEP*

>peptide 3 (44 aa)
MLSQLFVFHKSKNFTSDYEIRMPPTVPVNHYSDPEGQQNRIEIL*

Sequence

>CNT30566047
TTTATGGTTGAGACTAGGACGGTATCTGATCGTCTTCGAGCCCCCAACTTTCGTTCTTGATTAATGAAAACATCCTTGGCAAATGCTTTCGCAGTTGTTC
GTCTTTCATAAATCCAAGAATTTCACCTCTGACTATGAAATACGAATGCCCCCGACTGTCCCTGTTAATCATTACTCCGATCCCGAAGGCCAACAGAATA
GGATCGAAATCCTATGATGTTATCCCATGCTAATGTATCCAGAGCGTAGGCTTGCTTTGAGCACTCTAATTTCTTCAAAGTAACAGCGCCGGAGGCACGA
CCCGGCCAGTTAAGGCTAGGAGCGCATCGCCGGCAGAAGGGACGAGACGACCGGTGCACACCTGAAGGCGGACCGGTCGGCCCAACCCAAAATCCAACTA
CGAGCTTTTTAACTGCAACAACTTAAATATACGCTATTGGAGCTGGAATTACCGCGGCTGCTGGCACCAGACTTGCCCTCCAATGGATCCTCGTTAAGGG
ATTTAGATTGTACTCATTCCAATTACCAGACTCAATGAGCCCGGTATTGTTATTTATTGTCACTACCTCCCCGTGTCAGGATTGGGTAATTTGCGCGCCT
GCTGCCTTCCTTGGATGTGGTAGCCGTTTCTCAGGCTCCCTCTCCGGAATCGAACCCTAATTCTCCGTCACCCGTTAACACCATAGTAGGCCACTATCCT
ACCATCGAAAGTTGATAGGGCAGAAATTTGAATGATGCGTCGCCGGCACGAAGGCTAGGAGCGCATTGCCAATAGAAGGGACAAGATGACCGGTGCACAC
CTAAAGGCAGACCGGACGGCCCAATCCAAAATCCAACTACGAGTTTTTTAATTACAACAACTTAAATAT