Detailed information on CNT30564637


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9SQL2|CB24_PEA, E-value = 2e-100

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30675792Actinidia chinensisSetaria viridis17.2128.1284.18196forward
CNT30523464Actinidia chinensisSetaria italica17.2129.1284.18196forward
CNT30513114Actinidia chinensisJuglans regia12.2948.4485140forward
CNT30728535Actinidia chinensisCorchorus capsularis8.4327.8387.596forward
CNT30381598Actinidia chinensisManihot esculenta12.8226.2684.93146forward
CNT30631290Actinidia chinensisVigna unguiculata6.4122.686.373forward
CNT30487770Actinidia chinensisOlea europaea22.9157.8779.69261forward
CNT30506853Actinidia chinensisNicotiana attenuata6.0621.8486.9669forward
CNT30708791Actinidia chinensisGlycine max25.2939.2981.6288forward
CNT30300292Actinidia chinensisTriticum aestivum15.1967.3287.28173forward
CNT30224179Actinidia chinensisHordeum vulgare7.5520.3886.0586forward
CNT30395365Actinidia chinensisTriticum turgidum7.5531.584.8886forward
CNT30591239Actinidia chinensisMusa acuminata6.5826.798875forward
CNT3084615Actinidia chinensisVigna radiata28.4528.0880.25324forward
CNT30554639Actinidia chinensisOryza glaberrima14.1460.7587.58161forward
CNT30144765Actinidia chinensisMedicago truncatula6.9426.1689.8779forward
CNT30138628Actinidia chinensisLolium perenne11.7628.4587.31134forward
CNT30205828Actinidia chinensisHelianthus annuus10.7131.6987.7122forward
CNT30684486Actinidia chinensisTriticum urartu6.2333.1885.9271forward
CNT30596737Actinidia chinensisOryza meridionalis14.1426.4887.58161forward
CNT30358059Actinidia chinensisLactuca sativa21.9523.5282250forward
CNT30573808Actinidia chinensisVitis vinifera28.4550.9482.72324forward
CNT3038035Actinidia chinensisCucumis melo13.4331.0381.05153forward
CNT30103189Actinidia chinensisOryza rufipogon7.3736.2188.184forward
CNT30117453Actinidia chinensisOryza nivara14.1420.4387.58161forward
CNT30604463Actinidia chinensisOryza punctata25.7224.9882.25293forward
CNT30723304Actinidia chinensisLupinus angustifolius6.3225.3584.7272forward

Expression of CNT30564637

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MLQEVVKWPLSGHIVLNHKSQECQHGQSPCTRITHH*

>peptide 2 (32 aa)
LHSSASLYMKGFWFTMKHKSHSKTLLSLMITN*

>peptide 3 (86 aa)
MNSITNRVEDEAKYSAFPASYHLGTLIIPILVKTSGNSIPATPNMAQRLLTSSAWTYHFKFSGSSARPSGSNPLSPGRLEENKQFY*

>peptide 4 (75 aa)
MANLPAQESHIISPNLCKTYQGIEDATGVAKLMGREAVVLEDGVLVDAAWVLNVLPSPDLDIVEQDELNHEQGRG*

>peptide 5 (65 aa)
MFEQLCCAMGQTDAARGCQMAPFRSHCVEPQIPGMPTWPISLHKNHTSLAQIFAKPTRGLKMLPG*

>peptide 6 (46 aa)
MRAKVAYPYLGAISTNLFLCCCWLWNDFVGPRYCHIGRFYDTFPWCP

Sequence

>CNT30564637
AATTGCATAGTAGCGCTTCCCTGTACATGAAAGGTTTCTGGTTTACAATGAAGCACAAGTCTCACTCTAAAACCCTCCTTTCACTCATGATTACAAACTG
AATAAAAACAAGATCTTCTTTTCACTTCTCGTCGATTTAGTTCCAACCGAATGTTTGAACAATTGTGTTGTGCCATGGGTCAGACAGATGCTGCAAGAGG
TTGTCAAATGGCCCCTTTCCGGTCACATTGTGTTGAACCACAAATCCCAGGAATGCCAACATGGCCAATCTCCCTGCACAAGAATCACACATCATTAGCC
CAAATCTTTGCAAAACCTACCAGGGGATTGAAGATGCTACCGGGGTAGCCAAGCTCATGGGGAGGGAGGCTGTAGTTCTTGAAGATGGGGTCCTGGTTGA
CGCAGCCTGGGTTCTTAATGTCCTGCCATCTCCGGATCTCGACATAGTGGAACAAGATGAACTCAATCACGAACAGGGTCGAGGATGAGGCGAAATACTC
TGCTTTTCCCGCGTCGTACCACTTGGGGACGTTGATTATTCCGATACTCGTAAAAACTTCCGGCAACAGCATTCCGGCCACCCCCAACATGGCCCAGCGG
CTGTTGACCAGCTCGGCTTGGACATACCACTTCAAATTCTCGGGATCCTCGGCTAGGCCTAGTGGGTCGAACCCGTTGTCACCTGGTAGACTGGAAGAAA
ATAAACAATTCTATTAAAGTTTACCTGCCGTTCAGGTAGTCTGGGGAGGGCAAGCCCGGTAACCACTCTCCTTTCTTGGCTTCGACTTTGAATGTCCTCG
GCGATGAAGATTTTGCCGGTTTAACAGAGATTTTGTTTGCGGGAGAACCGGTAAGGAACCGGGATTTCGCAGCGCATGGCCGGAAGACAGCGGTGGACGC
CTGTGCAGTGACGGTGGCCATTTACTCCGCCCTGAATTTTCCGGTGGAGGGAGAAGGTTGTGAGTCCTTGACGGGGAGCACTGTTATATGATTGGCCAAT
GAGAGCCAAGGTAGCTTATCCTTATCTAGGTGCCATATCCACAAATCTATTCCTTTGTTGCTGTTGGTTGTGGAATGATTTTGTGGGTCCTAGGTATTGC
CACATAGGAAGATTTTATGATACATTTCCTTGGTGTCCA