Detailed information on CNT30562820


BLAST search results

BLAST vs Swiss-Prot:
sp|O49169|EF1A_MANES, E-value = 3e-59

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30503993Actinidia chinensisNicotiana attenuata48.8484.3686.64232forward
CNT30312278Actinidia chinensisCamelina sativa57.8990.7686.55275forward
CNT30265127Actinidia chinensisBrassica rapa30.5356.8687.59145forward
CNT3053016Actinidia chinensisAmborella trichopoda63.3732.6583.39301forward

Expression of CNT30562820

Peptides detected in this lncRNA

>peptide 1 (76 aa)
MSLTANRPSGGYAEKVSTTMGLVGIILMIPASPFFKNLGSFSISLPDRRSILVMSSANLTAMWEVWQSRTGAYPLPI

Sequence

>CNT30562820
AAGACAAAAACTATAGCAAGACAAGAAATGAACTACTAGACCAACTAAATAACTTGGGACCATAAAAATGGAATAAGCAGGGTGTTTTTTTATGACTCTA
ATAAATAGGATTTGAAGCATTCTTCAATTGAAACTCGGAACTGCAATCTTCACTTCTTCTTAGCAGCAGATTTGGTGACTTTGGCACCAGACGGGTCCTT
CTTCTCCACACTCTTGATAACACCAACAGCAACAGTCTGACGCATGTCCCTGACAGCAAATCGTCCTAGCGGTGGGTACGCAGAGAAAGTCTCCACAACC
ATGGGCTTGGTTGGAATCATCTTGATGATCCCAGCATCACCGTTCTTCAAGAACTTGGGCTCCTTCTCAATCTCCTTGCCAGATCGGCGGTCAATCTTGG
TCATGAGCTCAGCAAACTTGACCGCAATGTGGGAAGTGTGGCAATCAAGAACTGGAGCATATCCATTACCAATCT