Detailed information on CNT30562313


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9FFD8|MBS2_ARATH, E-value = 8e-48

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30516940Actinidia chinensisJuglans regia33.988.5381.9210forward
CNT30598181Actinidia chinensisFraxinus excelsior10.5222.2689.2365forward
CNT30687535Actinidia chinensisTriticum urartu13.5926.7586.984forward
CNT30348261Actinidia chinensisEragrostis tef16.0234.1488.8999forward
CNT30102338Actinidia chinensisOryza rufipogon32.6931.8185.64202forward

Expression of CNT30562313

Peptides detected in this lncRNA

>peptide 1 (55 aa)
MLGVVVNLHGFEVGCGDLAQRALQFGVAALLHPGSVGLPRLSATPVRCRRIQLRR*

>peptide 2 (83 aa)
MDLRSGAVTLHRGHSSLAWPPFSIPDLSACPAFPPPLFVVAASSFAANSFAVCFFGFAFPVIFFLSLYCDFSTNKQQFPTPNQ*

Sequence

>CNT30562313
GCTCCATCCATAACCATAACCATAAGCTCCATTAAAGTTGGATAAAACATAATATAATACTCCAGTAGCCATAGCCAGAGTACCCACCCAACGCAACGCA
ACAAGCAACAACATCAGAGTAATTAAAAGTTTTAACTAGGGGTGGGGGTTTAGAAATTATTTATTTATTTCTTGAGGCTTCCGCGGACGCCAGGGCGAGG
CTTGGTGCCGGAAGGCTCGGCTGCGACGGTGGCGTGGAGCTTGGGATGCTTGGCGTCGTGGTGAATCTGCATGGATTTGAGGTCGGGTGCGGTGACCTTG
CACAGAGGGCACTCCAGTTTGGCGTGGCCGCCCTTCTCCATCCCGGATCTGTCGGCCTGCCCCGCCTTTCCGCCACCCCTGTTCGTTGTCGCCGCATCCA
GCTTCGCCGCTAACTCCTTCGCCGTGTGCTTCTTCGGCTTCGCCTTCCCCGTCATCTTCTTCCTCTCTTTGTATTGTGATTTTTCGACAAACAAACAACA
ATTTCCCACTCCCAATCAGTGACACTATTTATGGACAATCTTCGATATTGGGTTGCGGTTATGGAGGATATACGGGCGGAACAAGGAGAAACTGGCGAAC
GGTAGGGGTGGATTTTGG