Detailed information on CNT30562270


BLAST search results

BLAST vs Swiss-Prot:
sp|P08222|CB22_CUCSA, E-value = 6e-105

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30380492Actinidia chinensisManihot esculenta37.1136.288.3265forward
CNT30629553Actinidia chinensisVigna unguiculata62.3255.9783.82445forward
CNT30709643Actinidia chinensisGlycine max62.1846.1185.81444forward

Expression of CNT30562270

Peptides detected in this lncRNA

>peptide 1 (76 aa)
MDQTRVAQVVKSTLTEDLGAGLEPDGLTKLDPVAGQNSGKTHPRAPSMAYLSWITSSSQFLAKVSGSTESPAVSQP*

>peptide 2 (32 aa)
MASLPFLISFTFSSANASGSSARPNGSKLPPG*

>peptide 3 (55 aa)
QLKRKIDIFCITTIQFTSHTFQIQNPPFNFPSLSGDKVGGISPGIVVNWVSKMIG*

Sequence

>CNT30562270
GCAGTTAAAACGGAAAATTGACATTTTTTGCATTACTACAATCCAATTTACATCACACACTTTCCAAATTCAAAACCCTCCTTTTAATTTCCCCTCACTT
TCCGGGGACAAAGTTGGTGGCATAAGCCCAGGCATTGTTGTTAACTGGGTCAGCAAGATGATCGGCTAAATTCTCTAATGGTCCCTTTCCGGTCACAATT
GCCTGGACAAAGAATCCAAACATAGAGAACATGGCCAGTCTACCATTCTTGATCTCCTTTACCTTCAGCTCAGCAAATGCCTCTGGGTCGTCAGCCAGGC
CCAATGGGTCAAAGCTTCCACCAGGGTAGAGTGGGTCGGTGATCTCACCGAGTGGCCCACCTGCAATACGGTATCCCTCCACCGCGCCCATCAAGATAAC
TTGGCATGCCCAAATGGCAAGAATGCTTTGGGCATGGATCAAACTAGGGTTGCCCAAGTAGTCAAGTCCACCCTCACTGAAGATCTGGGAGCCGGCCTTG
AACCAGACGGCCTCACCAAACTTGACCCCGTTGCGGGCCAAAACTCGGGAAAGACACATCCAAGAGCTCCAAGCATGGCCTATCTGTCGTGGATCACCTC
TAGCTCGCAGTTCTTGGCAAAAGTTTCGGGGTCAACTGAAAGTCCAGCAGTATCCCAACCATAGTCACCAGAAAATTCTCCGGTCAAGTAGGATGGGGGC
TCACCAGAGAGTGG