Detailed information on CNT30562217


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CH33|UBQ11_ARATH, E-value = 3e-159

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30528694Actinidia chinensisEucalyptus grandis69.1263.1686.35696forward
CNT30513419Actinidia chinensisJuglans regia65.4476.9986.49659forward
CNT30379426Actinidia chinensisManihot esculenta65.7457.1786.56662forward
CNT30712768Actinidia chinensisGlycine max67.9269.6586.7684forward
CNT3044343Actinidia chinensisPrunus dulcis67.8377.4485.8683forward
CNT30229606Actinidia chinensisAnanas comosus67.2351.0986.26677forward
CNT30153569Actinidia chinensisPrunus persica68.0275.9485.4685forward
CNT3032244Actinidia chinensisTheobroma cacao65.6457.5385.48661forward
CNT3026616Actinidia chinensisPopulus trichocarpa64.5566.7485.23650forward
CNT30327242Actinidia chinensisAsparagus officinalis67.5368.3484.71680forward
CNT30174646Actinidia chinensisVigna angularis67.5365.2686.91680forward

Expression of CNT30562217

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MVSELSTSRVMVLPVRVLTKICMPPRRRRTRWRVDSFWML*

>peptide 2 (40 aa)
MVSELSTSRVIVFPVRVLTKICMPPRRRRTRCRVDSFCML*

>peptide 3 (40 aa)
MPSLSWIFALTLSMVSELSTSRVMVLPVRVLTKICICTSQ*

Sequence

>CNT30562217
GGGCAAACATCACTTCCACTGCAATGATAAAACCACAAGAAACTGAACAACACCATCCACTGAACTAAAAGAAAAGCACAAACGATTTATTGATAACCCA
TGTTAGGGTAACACACAATACCAACTAAAATATAAAGAGAACCACATCACTCCAAATCATAGGGAAATCAAATAGAAGCCATGGACAGTTTTTGGAAACC
ACCACAGACAAGGTGAAGGGCCCTTGACTCCTGGATTTTAGAAACCTCCACGGAGACGAAGCACAAGGTGAAGGGTTGACTCCTTCTGGATGTTATAATC
TGCAAGGGTTCGGCCATCCTCGAGCTGCTTCCCAGCAAAGATCAGCCTCTGCTGATCTGGTGGGATCCCCTCCTTGTCCTGAATTTTTGCCTTGACATTG
TCAATGGTATCAGAGCTTTCAACCTCAAGGGTAATAGTTTTTCCGGTGAGGGTCTTGACAAAAATCTGCATGCCACCGCGGAGGCGGAGGACAAGGTGCA
GGGTCGATTCCTTCTGTATGTTGTAGTCTGCTAGGGTGCGGCCATCCTCAAGCTGTTTGCCGGCGAAGATCAGCCTCTGCTGGTCCGGTGGGATCCCTTC
CTTGTCTTGAATCTTGGCCTTGACATTGTCAATGGTGTCGGAGCTTTCCACCTCGAGGGTGATGGTCTTGCCTGTGAGGGTCTTAACGAAGATCTGCATG
CCACCACGGAGGCGGAGGACGAGGTGGAGGGTAGACTCCTTCTGGATGTTGTAGTCCGCTAGGGTGCGGCCGTCCTCGAGCTGCTTTCCAGCAAAGATCA
GCCTTTGCTGGTCTGGTGGGATGCCTTCTTTGTCCTGGATCTTTGCCTTGACATTATCGATGGTGTCAGAGCTTTCCACCTCGAGGGTGATGGTCTTGCC
GGTGAGGGTCTTAACGAAGATCTGCATCTGTACATCCCAATAATACAATTTAAAAAAAAAATCAAATCTATCCATAATAGAAACACGCTAATTAAACAAT
GACATCC