Detailed information on CNT30559586


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30523536Actinidia chinensisSetaria italica43.3761.9580350forward
CNT30535924Actinidia chinensisEucalyptus grandis34.8295.982.21281forward
CNT30316024Actinidia chinensisCorylus avellana62.3362.4881.11503forward
CNT30700805Actinidia chinensisQuercus lobata24.7866.0182200forward
CNT30616384Actinidia chinensisSesamum indicum30.6136.6585.43247forward
CNT30267763Actinidia chinensisChenopodium quinoa36.3142.0482.59293forward
CNT30489068Actinidia chinensisOlea europaea54.7789.4780.54442forward
CNT30710529Actinidia chinensisGlycine max38.1754.6184.42308forward
CNT3042412Actinidia chinensisPrunus dulcis39.2842.7882.65317forward
CNT3091732Actinidia chinensisSolanum tuberosum77.254.780.42623forward
CNT30591824Actinidia chinensisMusa acuminata33.4668.3581.85270forward
CNT30171519Actinidia chinensisTrifolium pratense13.5132.0686.24109forward
CNT30263540Actinidia chinensisBrassica rapa54.468.0679.95439forward
CNT3016764Actinidia chinensisZea mays46.7267.0880.64377forward
CNT30216752Actinidia chinensisKalanchoe fedtschenkoi22.9239.9682.7185forward
CNT30648676Actinidia chinensisRosa chinensis37.340.483.06301forward
CNT30205103Actinidia chinensisHelianthus annuus71.6281.6477.85578forward
CNT30625385Actinidia chinensisDaucus carota34.942885.46282forward
CNT30366537Actinidia chinensisSorghum bicolor21.8120.1886.93176forward
CNT30620207Actinidia chinensisCajanus cajan41.1415.4580.42332forward
CNT30596739Actinidia chinensisOryza meridionalis33.2141.2380.22268forward
CNT30154712Actinidia chinensisPrunus persica88.7291.9178.07716forward
CNT30573937Actinidia chinensisVitis vinifera37.4246.4687.42302forward
CNT30705862Actinidia chinensisPrunus avium61.2146.5282.39494forward
CNT3028162Actinidia chinensisTheobroma cacao42.6361.3280.52344forward
CNT3023560Actinidia chinensisPopulus trichocarpa56.8896.4379.74459forward
CNT30120999Actinidia chinensisCitrus clementina70.3842.3281.51568forward
CNT30330868Actinidia chinensisDioscorea rotundata17.7221.4187.41143forward
CNT30558075Actinidia chinensisPanicum hallii20.3220.7985.98164forward

Expression of CNT30559586

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MLDCMDSMATFLDCSVNKQGMDCILLMKDCNSEM*

>peptide 2 (32 aa)
MREKWGYMREMWGCKLVKWGCSLVKWGCSLEM*

>peptide 3 (29 aa)
MLDCSLETLDCSLEMLDCNLEKLGYRQGR*

Sequence

>CNT30559586
CTGTAATTAGGGGATGTTGGACTGTATGGACTCGATGGCGACATTCTTGGACTGCTCGGTGAATAAGCAAGGGATGGACTGTATTTTGCTGATGAAGGAT
TGTAACTCGGAGATGTAGGGCTGTAGCTCGGAGATGTTGGACTGTAGCTTGGAGACGTTGGACTGTAGCTTGGAGATGTTGGACTGTAACCTGGAGAAGT
TGGGCTATAGGCAGGGGAGGTAGGGCTATACGAGGGAGACGTTGGACTATAAGAGGGTGAGGTGGGGCTATATGCGGGAGAAGTGGGGCTATATGCGGGA
GATGTGGGGCTGTAAGCTGGTGAAGTGGGGCTGTAGCTTGGTGAAGTGGGGCTGTAGCTTGGAGATGTAGGGCTGTAGCTTGGGGATGTAGGACTATAAC
TGGGTGATGTGGGCGAGTAAGACGGACTTGTAGGAGAATACGTAGGGCTTGTTGGACTATACCCTGGAGAGCTTGGACTATATGTTGGAGACGTGGGGCT
GTAACCAGGAGAGGTAGGACTATATCCAGGAGACGACGGACTATATCCAGGAGAAGAGGGGCTGTAACCTGGGGATGATGCAGGAGAGAAGCCCATCCCA
CCAACATACGGAGAAAACTGGGCATCTGTAATTGGTGACAGACGAAGATTTGGGCTTAGCAAGTAATTAGGTGACATCATCCCATCATGATAAGGGGTAC
CCGTAATTGGTGAACGGGCAGGCGTCATGCCAAAGTCCAATCCTTCCATGTAACTAGGAAGCTGAATATCAATAGCATGCTGCAGCATCTGCTCGTTTAG
TAACAAA