Detailed information on CNT30536082


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30523536Eucalyptus grandisSetaria italica62.6765.6680.05371forward
CNT30316118Eucalyptus grandisCorylus avellana47.4739.3683.99281forward
CNT30549166Eucalyptus grandisIpomoea triloba45.9540.4882.35272forward
CNT30516792Eucalyptus grandisJuglans regia96.6264.2782.17572forward
CNT30500604Eucalyptus grandisCoffea canephora49.4947.6482.25293forward
CNT30616460Eucalyptus grandisSesamum indicum80.9133.3880.17479forward
CNT30269232Eucalyptus grandisChenopodium quinoa71.9666.9879.11426forward
CNT3021339Eucalyptus grandisCitrullus lanatus91.2285.1779.63540forward
CNT30727660Eucalyptus grandisCorchorus capsularis90.0397.4478.8533forward
CNT30378927Eucalyptus grandisManihot esculenta98.1493.8684.34581forward
CNT30524942Eucalyptus grandisPhaseolus vulgaris70.4462.1579.62417forward
CNT30628784Eucalyptus grandisVigna unguiculata69.9354.480.68414forward
CNT30490956Eucalyptus grandisOlea europaea52.0373.3380.19308forward
CNT30506120Eucalyptus grandisNicotiana attenuata33.2833.6883.76197forward
CNT30708216Eucalyptus grandisGlycine max43.4145.9781.71257forward
CNT3042435Eucalyptus grandisPrunus dulcis91.5578.3280.63542forward
CNT3091361Eucalyptus grandisSolanum tuberosum54.2243.6779.44321forward
CNT30304911Eucalyptus grandisTriticum aestivum37.8437.4681.25224forward
CNT30400271Eucalyptus grandisTriticum turgidum52.3662.6379.68310forward
CNT30559890Eucalyptus grandisActinidia chinensis50.6843.9282.33300forward
CNT30591924Eucalyptus grandisMusa acuminata89.0298.8778.18527forward
CNT3088022Eucalyptus grandisVigna radiata45.4462.2781.04269forward
CNT30508941Eucalyptus grandisSolanum lycopersicum49.1673.380.41291forward
CNT30554721Eucalyptus grandisOryza glaberrima52.0332.9480.84308forward
CNT30145737Eucalyptus grandisMedicago truncatula69.0966.479.71409forward
CNT30256659Eucalyptus grandisAvena sativa36.3230.0782.79215forward
CNT30312432Eucalyptus grandisCamelina sativa60.391.7781.51357forward
CNT3062262Eucalyptus grandisArabidopsis lyrata58.6163.3283347forward
CNT3079663Eucalyptus grandisBrassica juncea69.4377.2680.05411forward
CNT30263848Eucalyptus grandisBrassica rapa69.9397.8780.68414forward
CNT30468674Eucalyptus grandisSaccharum spontaneum44.4328.6880.99263forward
CNT30141877Eucalyptus grandisLolium perenne36.3247.9982.79215forward
CNT3016767Eucalyptus grandisZea mays67.2352.6580.4398forward
CNT30608057Eucalyptus grandisGossypium raimondii72.372.1884.81428forward
CNT30205370Eucalyptus grandisHelianthus annuus52.5347.6382.32311forward
CNT30713436Eucalyptus grandisMalus domestica golden28.7252.884.12170forward
CNT30625547Eucalyptus grandisDaucus carota54.0530.8380320forward
CNT30687113Eucalyptus grandisTriticum urartu53.5559.5980.44317forward
CNT30350936Eucalyptus grandisEragrostis tef49.3264.1882.88292forward
CNT30366857Eucalyptus grandisSorghum bicolor52.8731.8781.47313forward
CNT30596736Eucalyptus grandisOryza meridionalis41.3932.4581.63245forward
CNT30370935Eucalyptus grandisOryza glumipatula40.882582.23242forward
CNT30154777Eucalyptus grandisPrunus persica98.1472.6281.07581forward
CNT30410142Eucalyptus grandisPapaver somniferum99.3289.3679.76588forward
CNT30573855Eucalyptus grandisVitis vinifera97.9796.3580.86580forward
CNT30642028Eucalyptus grandisCannabis sativa85.4798.8380.83506forward
CNT3027877Eucalyptus grandisTheobroma cacao64.1996.283.16380forward
CNT3051605Eucalyptus grandisAmborella trichopoda97.887.3378.24579forward
CNT30121049Eucalyptus grandisCitrus clementina99.6654.5382.37590forward
CNT3035176Eucalyptus grandisCucumis melo87.6794.3677.65519forward
CNT30330867Eucalyptus grandisDioscorea rotundata48.9940.1180.34290forward
CNT30150463Eucalyptus grandisBrachypodium distachyon38.3425.8281.94227forward
CNT30103004Eucalyptus grandisOryza rufipogon37.8422.4782.59224forward
CNT30577473Eucalyptus grandisOryza barthii37.3340.5581.45221forward
CNT30584450Eucalyptus grandisEchinochloa crusgalli52.5341.5282.32311forward
CNT30497833Eucalyptus grandisDigitaria exilis5033.5681.08296forward
CNT30176441Eucalyptus grandisVigna angularis48.9947.9380290forward
CNT30558075Eucalyptus grandisPanicum hallii36.3227.2581.86215forward
CNT30551544Eucalyptus grandisOryza brachyantha43.4136.9882.49257forward
CNT30335475Eucalyptus grandisCynara cardunculus50.5123.0280.94299forward

Expression of CNT30536082

Peptides detected in this lncRNA

>peptide 1 (68 aa)
MLGCNQEMWGYKLVKLGCRKEMWGCKKVKLGCRMERSGYKMVRWGCMQGKWGYMQVMWGYKQERLDYN*

>peptide 2 (30 aa)
MQDLLGYNQENLDCRLEMWGCSQEMWGCSQV

>peptide 3 (36 aa)
LEMWDCKDWTVTILDCLVSTPMMGCILPTEGCNSEK*

Sequence

>CNT30536082
GTTTGGAGATGTGGGACTGTAAGGACTGGACGGTGACAATCTTGGACTGCTTGGTGAGTACGCCAATGATGGGCTGTATTTTGCCGACTGAGGGTTGTAA
CTCGGAGAAGTAGGGCTGTAGCTCGGTGAAGTTGGGCTGTAACTTGGTGATGTTGGGCTGTAACCAGGAGATGTGGGGCTATAAGCTGGTGAAGTTGGGC
TGTAGGAAGGAGATGTGGGGCTGTAAGAAGGTGAAGTTGGGCTGTAGGATGGAGAGGTCGGGCTATAAGATGGTGAGGTGGGGCTGTATGCAGGGGAAGT
GGGGCTATATGCAGGTGATGTGGGGCTATAAACAGGAGAGGTTGGACTATAACTAGGTGATGTAGGGCTGTAACTGGGCGAAGTGGGGCTGTAGCTGGGA
GATGTAGGGCTATAAGATGGAGAAGTAGGGCTATAAGATGGGGAAGTGGGGCTATAGCTGGGAGAAGTGGGTGAATACGAAGGGCTTGTAGGTGAATATG
CAGGACTTGTTGGGCTATAACCAGGAGAACTTGGACTGTAGGTTGGAGATGTGGGGCTGTAGCCAGGAGATGTGGGGCTGTAGCCAGGTGAT