Detailed information on CNT30535768


BLAST search results

BLAST vs Swiss-Prot:
sp|P09003|MI25_TOBAC, E-value = 2e-57

BLAST vs NONCODE:
NONMTRT001482, E-value = 1e-143

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30222882Eucalyptus grandisHordeum vulgare56.839.4593.09376forward
CNT30592658Eucalyptus grandisMusa acuminata56.1916.9987.37372forward
CNT30435041Eucalyptus grandisAegilops tauschii29.6166.2293.88196forward
CNT30688229Eucalyptus grandisTriticum urartu56.812.5192.55376forward

Expression of CNT30535768

Peptides detected in this lncRNA

>peptide 1 (73 aa)
LFLNFGGNDDLRRMVSILDAQVIVERHVEAALVHDGFHPHSIIARYVEIRGLLHSPQGELLSERTYHSYVTQI*

Sequence

>CNT30535768
CCTTTTCCTTAATTTCGGGGGGAATGATGACCTCCGCCGGATGGTCTCCATTCTAGACGCCCAAGTCATAGTGGAGCGCCATGTGGAGGCGGCATTGGTC
CATGATGGCTTTCATCCGCATTCCATTATTGCGCGATATGTAGAAATTCGGGGGCTTCTACATTCGCCGCAAGGGGAGCTTTTGAGTGAACGCACCTATC
ACTCCTACGTCACTCAGATATAGGAAGATGGCACCCGAATCAATTTAAAAAAGACCTAAAGTTAGGCACTCGACAACAACAAGAGATCGTCCTGAAGACG
GGTGCGACGGGAAGAAGTGGCATTTGGAAGTGTTGCTGACTTAACATTTAGGTTTCGGCATAACAAAGCTTGCACTGTCTTTTCGCACTTAGGCGCACAG
CGTGCCATTGGTAATGATTCTAATACGGTGCCACAAATTCGCAAGCTGATCCTAAGTAATCGTTGTTCTTCATTGGATTCCGGAGGAACTACTTCGTTAG
GATTGGGGAATTGATGCGATTCTTCCTGAATAGCCTGGATTCTCCCGTCGAGAGTCACTTTGAAAGTATTACCTAAACTCTTCCGACTGAATATGATAAA
GCCTATAAAACAAGCAGCTACTATCATTTCTTCATTATAGATTAAGATCTTCTTCGAACTTA