Detailed information on CNT30535560


BLAST search results

BLAST vs Swiss-Prot:
sp|A0A072VMJ3|CN15C_MEDTR, E-value = 2e-55

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30535560

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MLCDCHQQVLIFLSKSQVHWFLYCVHRIRS*

>peptide 2 (32 aa)
MLPLLSQLLLCGWKRGAQYLGVGQGPMLAVLRH

Sequence

>CNT30535560
ATATCATACAGTGGGGCCTGGATCCTTACATGTACGACTAAAGTAGATTACATTACTCAGGTCTATGGTGAAGCTGTATAATTTACATAAAAGGGCAAGG
CCTCGATGCTTTGTGATTGCCATCAGCAAGTCCTAATATTCCTCAGCAAAAGCCAGGTCCACTGGTTTCTGTATTGTGTTCACAGAATCAGAAGTTGACC
CTGCTTGTTTTTTCTCATCCCTTCTGGTACTCTCTATCAGCTCTGTCGCATACACGTCCCAAAACGACCTTAAAGGTCTCAACTTACCATTCATACTATT
TTCTCTCTCTCTTAGCTTAGCTTCCTCCTTCAACATTTTATGACGGCGCCATGAGCATTGAATAAGACATGCAGCCCACGTACGCCACTGATGTGAGTAG
AACCTAAACTTGTGCCTCAGTTCTCTGCTGTGCAGTCTTCTGAATTGCGACGCAACAAACTTTAGGTCCTCAGCAGCAAGAGAATATGCTTCCACTTCTT
TCACAGCTTTTACTGTGCGGGTGGAAGAGGGGAGCACAATACTTGGGCGTGGGTCAAGGGCCCATGTTAGCAGTTCTTCGCCAC