Detailed information on CNT30535503


BLAST search results

BLAST vs Swiss-Prot:
sp|Q96542|RBS_BETPN, E-value = 7e-59

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30727195Eucalyptus grandisCorchorus capsularis26.6514.1786.52230forward
CNT30402284Eucalyptus grandisBeta vulgaris23.8794.0681.55206forward
CNT30712618Eucalyptus grandisGlycine max28.1641.6181.48243forward
CNT30565197Eucalyptus grandisActinidia chinensis22.7116.7582.14196forward
CNT30613234Eucalyptus grandisArabis alpina26.339.8282.38227forward
CNT30623489Eucalyptus grandisDaucus carota22.4829.2681.96194forward
CNT30355778Eucalyptus grandisLactuca sativa22.7124.9483.67196forward
CNT30335392Eucalyptus grandisCynara cardunculus25.8427.3682.06223forward

Expression of CNT30535503

Peptides detected in this lncRNA

>peptide 1 (57 aa)
MFIFYKQHENGINFRLILMKNGPDNSRSRRWPDSLPPFLCTPAQRTFFHVSWNYGYS*

>peptide 2 (63 aa)
MGPTTRAHDAGQIHSHLFYAHQHRERSSMSAGTMATHENFHLKARVVEIDLSLNCFECREMIL*

>peptide 3 (42 aa)
TAEFIHRINRVLMQRICELKSTQISQDLGNKGKMDHSTSSYN*

Sequence

>CNT30535503
AACAGCTGAATTCATTCATAGAATAAATCGGGTCTTAATGCAACGCATCTGCGAACTCAAAAGTACACAAATATCACAGGACTTGGGTAATAAGGGAAAA
ATGGATCATTCGACATCTAGCTACAATTGAAAGGTTTGGAACGATGCCGCTTCGAGGGTAACCCCACGATCCACCATGACATAAGCTTGCTTAGAAGCCC
GGGGGCTTGAAGGCGATGAAACTGATGCACTGCACTTGACGCTTGTTGTCGAAGCCGATGATTCTGACGAAAGCGGTGGGGTAAGCCTTCTTGCACTCCT
CAAGCTCCTTCAACACCTGGGCCGAGTCGGTGCACCCGAACATGGGCAGCTTCCACATGGTCCAGTATCTCCCATCGTAGTACCCCGGGGAGTGGTGGTG
CTCACGGTAGTCGATTTCCTTCGCCAATTGTGTGGGAGTCAGGGGAGGAAGGTAGGACAGCGTCTCGAACTTCTTCAGCCCGACCGGTGGCCACACCTGC
CCATGTGCATCGACGTAAGTCTCAACTTATTCAGGACATTCAGGACATGTGTTGCTGCTAATAACCTCACTGACTAGAATCGTCGTTAGGAAATTCTCCT
AAGATGTTCATTTTCTACAAACAGCACGAAAATGGAATTAACTTCCGGTTGATTCTAATGAAGAATGGGCCCGACAACTCGCGCTCACGACGCTGGCCAG
ATTCACTCCCACCTTTTTTATGCACACCAGCACAGAGAACGTTCTTCCATGTCAGCTGGAACTATGGCTACTCATGAGAACTTCCATCTAAAGGCACGTG
TTGTAGAAATCGATCTAAGCCTGAATTGTTTCGAGTGCCGAGAAATGATTCTGTAAGCTAAAG