Detailed information on CNT30534929


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CH05|UBI2P_PETCR, E-value = 3e-44

BLAST vs NONCODE:
NONBNAT000172, E-value = 6e-22

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30534929

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MIAPSPITISGGSPHCTLFSASVVVISDETGMLSLW*

>peptide 2 (32 aa)
MRRACYRCGKVRRSHVISSGFMVLESGHISLL*

Sequence

>CNT30534929
GGCATCCAGATCTTCGTCAAAATCCTGACCGGCAAGACCCATCACTCCCGAGGTCGTGAGCTCCGACACCATTGACAACGTCAAGGCTAAGATCCAGGGT
AAGCACCGCATCCCTCCGATCAGCAGTGCCTCATCTTCTCGAGCATACAGCTCCAGAAGGCGGCCGTACCCTTGCCGACTACAACATCCAGAAGGAGTCA
CGCTCCATCTGGTGCTGCGGTTGAGGAGAGGTATACAGATCTTCGTCAAGTCCCTGATCAGCAAGACGATCACCCTTGAGGTGGAGAGCTTGCACAAGAT
CAACAATGTGAAGGCGAAGATTCAGGACGAGGAGGGGATTCTGCCGGATCAACAGAGGCTCATCTTCACCAGGACGCAGCTGGAGGATGATCGCACCCTC
GCCGATTACAATATCCGGAGGGAGTCCACACTGCACCTTGTTCTCTGCCTCCGTGGTGGTGATTTCTGATGAGACGGGCATGTTATCGTTGTGGTAAAGT
CAGGAGGTCTCATGTGATTTCATCTGGTTTCATGGTGCTTGAAAGTGGTCATATTTCCTTATTATAGACTTGTTGGTCATAGCTAGTTTTGGTGTAGTTT
TTCTTTTATGTAAATCGTGAATGAGTGAACCTTTGATTAAGT