Detailed information on CNT30534267


BLAST search results

BLAST vs Swiss-Prot:
sp|P27493|CB22_TOBAC, E-value = 4e-115

BLAST vs NONCODE:
NONSTUT001352, E-value = 4e-33

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30522354Eucalyptus grandisSetaria italica3736.8686.6373forward
CNT30641254Eucalyptus grandisNymphaea colorata57.0456.9983.65575forward
CNT30709832Eucalyptus grandisGlycine max58.8365.2484.65593forward
CNT30440443Eucalyptus grandisAegilops tauschii40.3863.386.73407forward
CNT30664832Eucalyptus grandisTriticum dicoccoides52.0857.6986.86525forward
CNT3013606Eucalyptus grandisZea mays46.2345.2986.7466forward
CNT30129909Eucalyptus grandisCorymbia citriodora63.3987.986.85639forward
CNT3055205Eucalyptus grandisAmborella trichopoda55.2663.0187.43557forward
CNT30579870Eucalyptus grandisEchinochloa crusgalli54.9655.7387554forward
CNT30556492Eucalyptus grandisPanicum hallii48.6153.4487.35490forward

Expression of CNT30534267

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MAHLQWMTSSSRFLAKVSGSAESPAVSQP*

>peptide 2 (39 aa)
MEILPLPRSSGVEGESFTACPARDGEERAMVEAAIVEWI*

>peptide 3 (57 aa)
MACTKNPNMENMASLPFLISFTLSSAKASGSSARPRWPRCFGRGSGWGCPGSRVPPR*

>peptide 4 (71 aa)
MGLGTWRGLDHTMGSQRRLACGRPSSWRFSHCREAREWRGRASPPVQPGMERREPWWKPPLLSGFESLTSV*

>peptide 5 (30 aa)
DQDRLDHRKLWRTRFADKSMKVKWQIMKEN*

Sequence

>CNT30534267
AAGATCAAGATCGCTTGGACCATAGAAAGCTTTGGAGGACAAGGTTTGCAGATAAATCTATGAAGGTTAAGTGGCAAATAATGAAGGAAAACTAGGGAAC
AAACGTGGGAGTCGAGTCGAAAAAGGAAGGAAGATGATTGAAGATGTCACTCAAGAGTCAAGCCAGCGGCAATACATGTAATTTACACTTCTGAAAGTAT
CGTTTCCAACCGAACTGTATATCACCCCTCACGCTCACTTTCCAGGGACGAAGTTGGTGGCATAGGCCCAAGCATTGTTGTTAACTGGATCAGCAAGGTG
GTCAGCCAAGTTCTCCAATGGGCCCTTTCCTGTCACAATGGCCTGCACGAAGAACCCGAACATGGAGAACATGGCAAGCCTGCCGTTCTTGATCTCCTTC
ACCTTGAGCTCAGCAAAGGCCTCGGGGTCATCGGCCAGGCCCAGATGGCCAAGATGCTTTGGGCGTGGATCAGGTTGGGGTTGCCCAGGTAGTCGAGTCC
CCCCTCGCTGAAGATCTGGGCGCCGGCCTTGAACCACACAGCCTCACCGAACTTGACGCCGTTGCGGGCCAGGAGCTCAGGGAAGACGCACCCTAGGGCG
CCGAGCATGGCCCACCTGCAGTGGATGACCTCGAGCTCGCGGTTCTTGGCGAAGGTCTCAGGGTCGGCCGAGAGCCCAGCAGTGTCCCAACCGTAGTCAC
CGGGGAACTCACCAGTGAGGTAGCTCGGGGGCTCACCGGAGAATGGGCCTAGGTACTTGGCGCGGTCTGGACCATACCATGGGCTCCCAGAGGAGACTGG
CTTGCGGACGGCCTTCCTCATGGAGATTCTCCCATTGCCGAGAAGCTCGGGAGTGGAGGGGGAGAGCTTCACCGCCTGTCCAGCCAGGGATGGAGAGGAG
AGAGCCATGGTGGAAGCCGCCATTGTTGAGTGGATTTGAGAGCTTGACCTCTGTCTAGTGTTGAAATAGAGAGTTGAGATGGATTGGCGATGGTTGTTGG
GACTTGTT