Detailed information on CNT30532887


BLAST search results

BLAST vs Swiss-Prot:
sp|P69322|UBIQP_PEA, E-value = 0.0

BLAST vs NONCODE:
NONMEST001181, E-value = 2e-166

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30727227Eucalyptus grandisCorchorus capsularis25.3659.4484.77683forward
CNT30156153Eucalyptus grandisPistacia vera33.5778.4783.19904forward
CNT3097262Eucalyptus grandisSolanum tuberosum41.1496.7782.491108forward

Expression of CNT30532887

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MVSELSTSRVMVLPVRVFTKICMPPLRRSTKWSVDSFWML*

>peptide 2 (31 aa)
MVSELSTSKVIVFPVRVLTKICIPPLKRRTK*

>peptide 3 (48 aa)
MECGLLLDVIISQGAPILELLACKDEPLLVWGNPLLVLDLGLYIVDCV*

>peptide 4 (44 aa)
MSLCWSGGIPSLSWILAFTLSIVSELSTSRVIVLPVRVFTKICI*

>peptide 5 (94 aa)
MESRLLLNVVIGQTPTILELLPCENQPLLVWGNSFLVLYLRFDVINRVRTLHFQGDSLAGKGLHKNLHASPQTQNQVKSRLFLDVIICQSPTIL*

>peptide 6 (50 aa)
MPSLSWIFAFTLSTVSELSTSKVMVFPVRVLTKICIPPRRRRTRWRVDSF*

>peptide 7 (29 aa)
ISSPIFICPSGRRVSRMSIAPSISNNGSK*

Sequence

>CNT30532887
TTATCTCGTCACCCATTTTCATTTGCCCTTCCGGGCGACGAGTTTCAAGAATGTCAATTGCACCAAGCATAAGTAACAACGGGAGTAAATAGCCTCAAAT
TTATTCAAAGTATAGAACCATCAGAACACATCGGAACTGACCCATAGCAAACAAAACCCAAAGGACCCAACTAGAGAGAGACAAACTTGACTTCCCAGAA
AAAACTCAGAAACCACCGCGGAGACGGAGGACCAAGTGCAGGGTCGACTCTTTCTGAATGTTATAGTCAGCCAGAGTCCTCCCGTCTTCGAGTTGCTTCC
CAGCAAAGATCAGCCTCTGCTGGTCCGGCGGGATGCCCTCCTTATCCTGGATCTTCGCCTTCACGTTGTCGACGGTGTCTGAACTCTCCACCTCCAAAGT
GATGGTCTTCCCGGTCAGGGTCTTGACAAAGATCTGCATCCCACCACGCAGACGGAGGACAAGATGGAGAGTCGACTCCTTTTGAATGTTGTAATCGGCC
AGACTCCTACCATCCTCGAGTTGCTTCCCTGCGAAAATCAACCGCTGCTGGTCTGGGGGAATTCCTTCCTTGTCCTGTATCTTCGCTTTGACGTTATCAA
TCGTGTCAGAACTCTCCACTTCCAAGGTGATAGTCTTGCCGGTAAGGGTCTTCACAAAAATCTGCATGCCTCCCCTCAGACGCAGAACCAAGTGAAGAGT
CGACTCTTTCTGGATGTTATAATCTGCCAGAGTCCTACCATCCTCTAGCTGTTTCCCAGCAAAAATAAGCCTCTGCTGATCCGGGGGAATGCCTTCCTTG
TCCTGAATTTTCGCTTTGACATTGTCGATGGTATCAGAGCTCTCCACTTCCAAAGTGATTGTCTTTCCAGTAAGGGTCTTGACAAAGATTTGCATTCCTC
CTCTCAAACGTAGGACCAAGTGAAGGGTGGATTCCTTCTGGATGTTGTAGTCTGCAAGCGTCCGGCCATCCTCAAGTTGCTTGCCAGCAAAGATCAACCG
CTGCTGGTCTGGGGGAATCCCTTCTTTGTCCTGAATTTTGGCCTTCACATTGTCAATGGTATCAGAACTCTCCACCTCAAGAGTAATGGTCTTGCCAGTG
AGGGTCTTCACAAAGATCTGCATGCCACCTCTCAGACGAAGCACCAAATGGAGTGTGGACTCCTTCTGGATGTTATAATCAGCCAAGGTGCGCCCATCCT
CGAGCTGCTTGCCTGCAAAGATGAGCCTTTGCTGGTCTGGGGGAATCCCCTCCTTGTCTTGGATCTTGGCCTTTACATTGTCGATTGTGTCTGAACTCTC
AACCTCTAGGGTGATAGTCTTGCCAGTAAGAGTTTTCACGAAGATTTGCATCTGAAAGATTCGAGGAAGTAATTAGACAATATAGAAAACAAGCTGCATG
TGTTATGCCATAATGCAAGAAATAGCGGGCAATAACAAGCCAGGTTATATTCAGTTCTACACTCTTTGAATCTTTATTACCATGCAGTGCTTAACTGCAT
GCAGGATCAGCACTAATTGGGATATAAAGAGACCACACTGTTCAGCTAAACGTATTATATAGCATCACATTCCTCCATGAATATACTTCAACTATAAGAA
AACGATCATCGTATTCACATCACCAAGCAAGACAGATCAAAGCGCCGGACCCCATAGTGCCAATCAATTGATAAATACACAAACCTTATGTCTTGTGCTA
TAATTGCAAGAAACAGTAGGTCCAGTCAAAGATCTAAAGTCTACAACACCAATCAATAAGCAAACACCGCGGATTTCATCTCAGACAACAAAACTCTAGG
TACCATAAGTAAATCACAATCCTACTGGTTAATCATCATGGCTTCAACAAACGATTAGACATACGTAAACAAGACAAAATAAACGGCTATGGACGATGCA
AGCGATGGGCAGAAAATTAAAATCTGAATGTACAAGACAATTTCATAAACCGCACCATCAACAAAATCATACGAACTGAGTTTCCTTCAACAAGACCGAC
ACAGGAAAAACCAAGGTCAAACCATTCCCTAAACGCAGCCTTCCTTAAGGGTTGCAGATCTACGAAGAAAATTTCGAAAAACCCAATTTTGGGCAGGAAG
GACAAGCACAAGGACGAGAAAGCAGATCGCATCACTAGACATACGCAACCGGCGGCATCTTCCAAGCAGAAAGCTAAAGATCAAAGCTCAATCAATCTGG
AAAACCTTTACACAACTCTGCCCTAAACCAAGAAGATCAAACAATCGAAACATGACAACCCAATCCCGAATCAGAAAGCGGAACATCTACACATAAAGGT
CCGAAATTCAGCCCAATCTCGCGAAGAGGATTATAATCTCACCGCCGTAAGAATCCACCAAAGGAGAAAAACCAGATCAAAGCTCAAATCAAAACGAAAA
ACCTCCCATACCTCGACAGATCTAGAGGAATCTAGAGGAAGAGTCGATTGAATTGAAGTAGCAAAAACGATCGAGATCAACAAGATCTCGGTGTTCCGAA
GAGGAGAGAATCGAGAACAATACCTTGAAAGAGGGATCGGGAGAAACACCGAGAGATCGGTCGATTGAAGAAGAGAAAATTTGAAGAGGCTTGTCGAAGA
AATTGTGAGGAGCTCGATGGGGGTTTGGTCCAATTTATAGGCCCTTAACGGCGCGCCTTGTCGGCGACGAGACCGAGGCGCGTTCTTTCCAGG