Detailed information on CNT30532219


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CG85|UBI1P_NICSY, E-value = 0.0

BLAST vs NONCODE:
NONMEST001181, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30500417Eucalyptus grandisCoffea canephora62.4352.1481.91050forward
CNT30279009Eucalyptus grandisChenopodium quinoa87.3496.1482.571469forward
CNT30379426Eucalyptus grandisManihot esculenta51.2574.4483.87862forward
CNT30525132Eucalyptus grandisPhaseolus vulgaris71.1175.0881.521196forward
CNT30629220Eucalyptus grandisVigna unguiculata49.1776.5782.95827forward
CNT30156103Eucalyptus grandisPistacia vera56.6680.4983.53953forward
CNT3086240Eucalyptus grandisVigna radiata75.0978.8981.391263forward
CNT30238962Eucalyptus grandisBrassica oleracea52.6845.8482.28886forward
CNT30172216Eucalyptus grandisTrifolium pratense52.5651.8882.13884forward
CNT30145547Eucalyptus grandisMedicago truncatula91.0876.9883.811532forward
CNT30311152Eucalyptus grandisCamelina sativa79.8583.2681.241343forward
CNT30460578Eucalyptus grandisSaccharum spontaneum64.6854.3783.181088forward
CNT30605389Eucalyptus grandisGossypium raimondii51.6188.0382.83868forward
CNT3066849Eucalyptus grandisLeersia perrieri63.0879.42821061forward
CNT30364985Eucalyptus grandisSorghum bicolor51.1383.8284.07860forward
CNT30418420Eucalyptus grandisPapaver somniferum64.9263.5382.051092forward
CNT3032754Eucalyptus grandisTheobroma cacao66.3585.0682.621116forward
CNT30120444Eucalyptus grandisCitrus clementina81.3385.7780.411368forward
CNT30595410Eucalyptus grandisEragrostis curvula64.6879.77831088forward
CNT30726149Eucalyptus grandisLupinus angustifolius51.5545.5482.47867forward

Expression of CNT30532219

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MVSELSTSRVMVLPVRVFTKICMPPLRRSTKWSVDSFWML*

>peptide 2 (50 aa)
MPSLSWIFAFTLSMVSELSTSKVMVFPVRVLTKICIPPRRRRTRWRVDSF*

>peptide 3 (48 aa)
MECGLLLNVIISQGAPILELLACKDEPLLVWGNPLLVLDLGLYIVDCV*

>peptide 4 (48 aa)
MECGLLLDVIISQGASILKLLPSKDEPLLVWGDSLLILNLGLNIVNCV*

>peptide 5 (31 aa)
MVSELSTSKVIVFPVRVLTKICIPPLKRRTK*

>peptide 6 (31 aa)
MVSELSTSKVIVLPVRVFTKICMPPLRRRTK*

>peptide 7 (37 aa)
MSLCWSGGIPSLSWILAFTLSIVSELSTSRVIVLPVRV

Sequence

>CNT30532219
CAATCCATCAGAAGACATCATAACTTTAAAATGGCCAACCAACCTAATAGACAGAAAAACTTGACTTCATGAAAAACCCTTCGGTGACATGAAAACTCAG
AAACCACCACGGAGACGGAGGACCAAGTGCAGAGTCGACTCTTTCTGGATGTTATAGTCAGCCAGAGTCCTCCCGTCTTCGAGTTGCTTCCCCGCAAAAA
TCAGCCTCTGCTGATCTGGCGGGATGCCTTCCTTATCCTGGATCTTTGCCTTCACGTTGTCGATGGTGTCTGAACTCTCCACCTCCAAAGTGATGGTCTT
TCCGGTCAGGGTCTTGACAAAGATCTGCATCCCACCACGCAGACGAAGGACGAGATGGAGAGTTGACTCCTTTTGAATATTGTAATCAGCCAGTGTCCTG
CCATCCTCAAGTTGCTTCCCTGCAAAAATCAACCGCTGTTGGTCTGGGGGGATTCCCTCCTTGTCCTGTATCTTTGCTTTGACATTATCGATCGTGTCAG
AGCTCTCCACCTCCAAGGTGATAGTCTTGCCAGTAAGGGTCTTTACAAAAATCTGCATGCCTCCCCTAAGACGCAGAACCAAGTGAAGAGTCGATTCTTT
CTGGATGTTATAATCTGCCAGAGTCCTGCCATCTTCTAGCTGCTTCCCAGCAAAAATGAGCCTCTGCTGATCTGGGGGAATGCCTTCCTTGTCCTGAATT
TTCGCTTTGACATTGTCGATGGTGTCAGAGCTCTCAACTTCCAAAGTGATAGTCTTGCCGGTAAGGGTCTTCACAAAAATCTGCATGCCTCCCCTCAGAC
GCAGAACCAAGTGAAGAGTCGACTCTTTCTGGATGTTATAATCTGCCAGAGTCCTACCATCCTCTAGCTGTTTCCCAGCAAAAATAAGCCTCTGCTGATC
CGGGGGAATGCCTTCCTTGTCCTGAATTTTCGCTTTGACATTGTCGATGGTATCAGAGCTCTCCACTTCCAAAGTGATTGTCTTTCCAGTAAGGGTCTTG
ACAAAGATTTGCATTCCTCCTCTCAAACGTAGGACCAAGTGAAGGGTGGATTCCTTCTGGATGTTGTAGTCTGCAAGCGTCCGGCCATCCTCAAGTTGCT
TGCCAGCAAAGATCAACCGCTGCTGGTCTGGGGGAATCCCTTCTTTGTCCTGAATTTTGGCCTTCACATTGTCAATGGTATCAGAACTCTCCACCTCAAG
AGTAATGGTCTTGCCAGTGAGGGTCTTCACAAAGATCTGCATGCCACCTCTCAGACGAAGCACCAAATGGAGTGTGGACTCCTTCTGGATGTTATAATCA
GCCAAGGTGCGTCCATCCTCAAGCTGCTTCCCAGCAAAGATGAGCCTCTGCTGGTCTGGGGGGATTCCCTCCTTATCTTGAATCTTGGCCTTAACATTGT
CAATTGTGTCTGAGCTTTCGACCTCAAGGGTAATGGTCTTGCCAGTGAGGGTCTTCACAAAGATCTGCATGCCACCTCTCAGACGAAGCACCAAATGGAG
TGTGGACTCCTTCTGAATGTTATAATCAGCCAGGGTGCGCCCATCCTCGAGCTGCTTGCCTGCAAAGATGAGCCTTTGCTGGTCTGGGGGAATCCCCTCC
TTGTCTTGGATCTTGGCCTTTACATTGTCGATTGTGTCTGAACTCTCAACCTCTAGGGTGATAGTCTTGCCAGTAAGAGTTT